PDB entry 2gc2

View 2gc2 on RCSB PDB site
Description: The crystal structure of phosphoglucose isomerase from Pyrococcus furiosus in complex with Fructose 6-phosphate and zinc
Class: isomerase
Keywords: cupin, phosphoglucose isomerase, fructose 6-phosphate, ISOMERASE
Deposited on 2006-03-13, released 2006-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.176
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucose-6-phosphate isomerase
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: pgiA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P83194 (1-187)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d2gc2a2, d2gc2a3
  • Chain 'B':
    Compound: Glucose-6-phosphate isomerase
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: pgiA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P83194 (1-187)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d2gc2b2, d2gc2b3
  • Heterogens: ZN, F6R, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gc2A (A:)
    mmykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveq
    eekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakw
    ismepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengev
    kvvdnprw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gc2B (B:)
    mmykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveq
    eekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakw
    ismepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengev
    kvvdnprw