PDB entry 2gc0

View 2gc0 on RCSB PDB site
Description: The crystal structure of phosphoglucose isomerase from Pyrococcus furiosus in complex with 5-phospho-D-arabinonohydroxamate and zinc
Class: isomerase
Keywords: cupin, phosphoglucose isomerase, 5-phospho-D-arabinonohydroxamate
Deposited on 2006-03-13, released 2006-04-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.169
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucose-6-phosphate isomerase
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: pgiA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P83194 (1-187)
      • cloning artifact (0)
    Domains in SCOPe 2.05: d2gc0a_
  • Chain 'B':
    Compound: Glucose-6-phosphate isomerase
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: pgiA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P83194 (1-187)
      • cloning artifact (0)
    Domains in SCOPe 2.05: d2gc0b_
  • Heterogens: ZN, PAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gc0A (A:)
    mmykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveq
    eekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakw
    ismepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengev
    kvvdnprw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gc0B (B:)
    mmykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveq
    eekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakw
    ismepgtvvyvppywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengev
    kvvdnprw