PDB entry 2gbs

View 2gbs on RCSB PDB site
Description: NMR structure of Rpa0253 from Rhodopseudomonas palustris. Northeast structural genomics consortium target RpR3
Class: structural genomics, unknown function
Keywords: alpha-beta, RpR3, NESG, Structural Genomics, Rpa0253, COG2947, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2006-03-11, released 2006-04-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hypothetical protein Rpa0253
  Species: Rhodopseudomonas palustris [TaxId:258594]
  Gene: rpa0253
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6ND56 (0-136)
    • engineered (0)
    • cloning artifact (137-144)
  Domains in SCOPe 2.08: d2gbsa1, d2gbsa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2gbsA (A:)
  vaywlvksepsvwswdqqvakgaageawtgvrnhsaklhmvamrrgdrafyyhsnegkei
  vgiaeiireaypdptdasgkfvcvdikadkplktpvtlaavkaeprladmalmkysrlsv
  qpvtaeewklvckmggllehhhhhh