PDB entry 2gbr

View 2gbr on RCSB PDB site
Description: Crystal Structure of the 35-36 MoaD Insertion Mutant of Ubiquitin
Class: protein binding
Keywords: loop insertion, protein binding
Deposited on 2006-03-10, released 2006-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62988 (0-End)
      • insertion (35-39)
    Domains in SCOPe 2.07: d2gbra_
  • Chain 'B':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62988 (0-End)
      • insertion (35-39)
    Domains in SCOPe 2.07: d2gbrb_
  • Chain 'C':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62988 (0-End)
      • insertion (35-39)
    Domains in SCOPe 2.07: d2gbrc_
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gbrA (A:)
    mqifvktltgktitlevepsdtienvkakiqdkegrwalaippdqqrlifagkqledgrt
    lsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gbrA (A:)
    mqifvktltgktitlevepsdtienvkakiqdkegrwalaippdqqrlifagkqledgrt
    lsdyniqkestlhlvlr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gbrB (B:)
    mqifvktltgktitlevepsdtienvkakiqdkegrwalaippdqqrlifagkqledgrt
    lsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gbrB (B:)
    mqifvktltgktitlevepsdtienvkakiqdkegrwalaippdqqrlifagkqledgrt
    lsdyniqkestlhlvlr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gbrC (C:)
    mqifvktltgktitlevepsdtienvkakiqdkegrwalaippdqqrlifagkqledgrt
    lsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gbrC (C:)
    mqifvktltgktitlevepsdtienvkakiqdkegrwalaippdqqrlifagkqledgrt
    lsdyniqkestlhlvl