PDB entry 2gbq

View 2gbq on RCSB PDB site
Description: solution nmr structure of the grb2 n-terminal sh3 domain complexed with a ten-residue peptide derived from sos direct refinement against noes, j-couplings, and 1h and 13c chemical shifts, 15 structures
Class: complex (signal transduction/peptide)
Keywords: complex (signal transduction/peptide), sh3 domain
Deposited on 1996-12-23, released 1997-09-04
The last revision prior to the SCOP 1.75 freeze date was dated 1997-09-04, with a file datestamp of 2007-06-04.
Experiment type: NMR15
Resolution: N/A
R-factor: 0.08
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: grb2
    Species: Mus musculus
    Gene: POTENTIAL
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2gbqa_
  • Chain 'B':
    Compound: sos-1
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ACE, NH2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gbqA (A:)
    gsrrasvgsmeaiakydfkataddelsfkrgdilkvlneecdqnwykaelngkdgfipkn
    yiemkphpefivtd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gbqA (A:)
    meaiakydfkataddelsfkrgdilkvlneecdqnwykaelngkdgfipknyiemkp
    

  • Chain 'B':
    No sequence available.