PDB entry 2gbn

View 2gbn on RCSB PDB site
Description: Crystal Structure of the 35-36 8 Glycine Insertion Mutant of Ubiquitin
Class: protein binding
Keywords: loop insertion, protein binding
Deposited on 2006-03-10, released 2006-05-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.206
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62988 (0-End)
      • insertion (34-41)
    Domains in SCOPe 2.04: d2gbna_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gbnA (A:)
    mqifvktltgktitlevepsdtienvkakiqdkegggggggggippdqqrlifagkqled
    grtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gbnA (A:)
    mqifvktltgktitlevepsdtienvkakiqdkegggggggggippdqqrlifagkqled
    grtlsdyniqkestlhlvlrl