PDB entry 2gbl

View 2gbl on RCSB PDB site
Description: Crystal Structure of Full Length Circadian Clock Protein KaiC with Phosphorylation Sites
Class: circadian clock protein, transferase
Keywords: CIRCADIAN CLOCK PROTEIN homohexamer, circadian, kaia, kaib, kaic, hexamer,, CIRCADIAN CLOCK PROTEIN, TRANSFERASE
Deposited on 2006-03-10, released 2007-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.23
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Circadian clock protein kinase kaiC
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene: kaiC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79PF4 (Start-518)
      • modified residue (430-431)
    Domains in SCOPe 2.07: d2gbla1, d2gbla2
  • Chain 'B':
    Compound: Circadian clock protein kinase kaiC
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene: kaiC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79PF4
      • modified residue (430-431)
    Domains in SCOPe 2.07: d2gblb1, d2gblb2
  • Chain 'C':
    Compound: Circadian clock protein kinase kaiC
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene: kaiC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79PF4
      • modified residue (431)
    Domains in SCOPe 2.07: d2gblc1, d2gblc2
  • Chain 'D':
    Compound: Circadian clock protein kinase kaiC
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene: kaiC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79PF4
      • modified residue (431)
    Domains in SCOPe 2.07: d2gbld1, d2gbld2
  • Chain 'E':
    Compound: Circadian clock protein kinase kaiC
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene: kaiC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79PF4
      • modified residue (430-431)
    Domains in SCOPe 2.07: d2gble1, d2gble2
  • Chain 'F':
    Compound: Circadian clock protein kinase kaiC
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene: kaiC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79PF4 (Start-518)
      • modified residue (430-431)
    Domains in SCOPe 2.07: d2gblf1, d2gblf2
  • Heterogens: MG, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gblA (A:)
    mtsaemtspnnnsehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqfl
    yngiiefdepgvfvtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvgg
    fdlsalierinyaiqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvm
    tterieeygpiarygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftit
    dhginifplgamrltqrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsr
    fvenacankerailfayeesraqllrnayswgmdfeemerqnllkivcaypesagledhl
    qiikseindfkpariaidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfm
    gahsitdshistitdtiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdik
    dsfrnferiisgsptritvdekselsrivrgvqekgpes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gblA (A:)
    ehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqflyngiiefdepgvf
    vtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvggfdlsalierinya
    iqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvmtterieeygpiar
    ygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftitdhginifplgamr
    ltqrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsrfvenacankerai
    lfayeesraqllrnayswgmdfeemerqnllkivcaypesagledhlqiikseindfkpa
    riaidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfmgahsitdshisti
    tdtiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdikdsfrnferiisgs
    ptritvdekselsrivrgvqekgpes
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gblB (B:)
    mtsaemtspnnnsehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqfl
    yngiiefdepgvfvtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvgg
    fdlsalierinyaiqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvm
    tterieeygpiarygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftit
    dhginifplgamrltqrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsr
    fvenacankerailfayeesraqllrnayswgmdfeemerqnllkivcaypesagledhl
    qiikseindfkpariaidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfm
    gahsitdshistitdtiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdik
    dsfrnferiisgsptritvdekselsrivrgvqekgpes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gblB (B:)
    ehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqflyngiiefdepgvf
    vtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvggfdlsalierinya
    iqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvmtterieeygpiar
    ygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftitdhginifplgamr
    ltqrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsrfvenacankerai
    lfayeesraqllrnayswgmdfeemerqnllkivcaypesagledhlqiikseindfkpa
    riaidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfmgahsitdshisti
    tdtiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdikdsfrnferiisgs
    ptritvdekse
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gblC (C:)
    mtsaemtspnnnsehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqfl
    yngiiefdepgvfvtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvgg
    fdlsalierinyaiqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvm
    tterieeygpiarygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftit
    dhginifplgamrltqrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsr
    fvenacankerailfayeesraqllrnayswgmdfeemerqnllkivcaypesagledhl
    qiikseindfkpariaidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfm
    gahsitdshistitdtiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdik
    dsfrnferiisgsptritvdekselsrivrgvqekgpes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gblC (C:)
    ehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqflyngiiefdepgvf
    vtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvggfdlsalierinya
    iqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvmtterieeygpiar
    ygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftitdhginifplgamr
    ltqrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsrfvenacankerai
    lfayeesraqllrnayswgmdfeemerqnllkivcaypesagledhlqiikseindfkpa
    riaidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfmgahsitdshisti
    tdtiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdikdsfrnferiisgs
    ptritvde
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gblD (D:)
    mtsaemtspnnnsehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqfl
    yngiiefdepgvfvtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvgg
    fdlsalierinyaiqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvm
    tterieeygpiarygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftit
    dhginifplgamrltqrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsr
    fvenacankerailfayeesraqllrnayswgmdfeemerqnllkivcaypesagledhl
    qiikseindfkpariaidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfm
    gahsitdshistitdtiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdik
    dsfrnferiisgsptritvdekselsrivrgvqekgpes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gblD (D:)
    ehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqflyngiiefdepgvf
    vtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvggfdlsalierinya
    iqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvmtterieeygpiar
    ygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftitdhginifplgamr
    ltqrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsrfvenacankerai
    lfayeesraqllrnayswgmdfeemerqnllkivcaypesagledhlqiikseindfkpa
    riaidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfmgahsitdshisti
    tdtiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdikdsfrnferiisgs
    ptrit
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2gblE (E:)
    mtsaemtspnnnsehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqfl
    yngiiefdepgvfvtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvgg
    fdlsalierinyaiqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvm
    tterieeygpiarygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftit
    dhginifplgamrltqrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsr
    fvenacankerailfayeesraqllrnayswgmdfeemerqnllkivcaypesagledhl
    qiikseindfkpariaidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfm
    gahsitdshistitdtiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdik
    dsfrnferiisgsptritvdekselsrivrgvqekgpes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gblE (E:)
    ehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqflyngiiefdepgvf
    vtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvggfdlsalierinya
    iqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvmtterieeygpiar
    ygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftitdhginifplgamr
    ltqrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsrfvenacankerai
    lfayeesraqllrnayswgmdfeemerqnllkivcaypesagledhlqiikseindfkpa
    riaidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfmgahsitdshisti
    tdtiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdikdsfrnferiisgs
    ptritvdeksel
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2gblF (F:)
    mtsaemtspnnnsehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqfl
    yngiiefdepgvfvtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvgg
    fdlsalierinyaiqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvm
    tterieeygpiarygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftit
    dhginifplgamrltqrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsr
    fvenacankerailfayeesraqllrnayswgmdfeemerqnllkivcaypesagledhl
    qiikseindfkpariaidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfm
    gahsitdshistitdtiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdik
    dsfrnferiisgsptritvdekselsrivrgvqekgpes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gblF (F:)
    ehqaiakmrtmiegfddishgglpigrstlvsgtsgtgktlfsiqflyngiiefdepgvf
    vtfeetpqdiiknarsfgwdlaklvdegklfildaspdpegqevvggfdlsalierinya
    iqkyrarrvsidsvtsvfqqydassvvrrelfrlvarlkqigattvmtterieeygpiar
    ygveefvsdnvvilrnvlegerrrrtleilklrgtshmkgeypftitdhginifplgamr
    ltqrssnvrvssgvvrldemcgggffkdsiilatgatgtgktllvsrfvenacankerai
    lfayeesraqllrnayswgmdfeemerqnllkivcaypesagledhlqiikseindfkpa
    riaidslsalargvsnnafrqfvigvtgyakqeeitglftntsdqfmgahsitdshisti
    tdtiillqyveirgemsrainvfkmrgswhdkairefmisdkgpdikdsfrnferiisgs
    ptritvdekselsrivrgvqekgpes