PDB entry 2gbk

View 2gbk on RCSB PDB site
Description: Crystal Structure of the 9-10 MoaD Insertion Mutant of Ubiquitin
Class: protein binding
Keywords: loop insertion, protein binding
Deposited on 2006-03-10, released 2006-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62988 (0-End)
      • insertion (9-15)
    Domains in SCOPe 2.07: d2gbka_
  • Chain 'B':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62988 (0-End)
      • insertion (9-15)
    Domains in SCOPe 2.07: d2gbkb_
  • Chain 'C':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62988 (0-82)
      • insertion (9-15)
    Domains in SCOPe 2.07: d2gbkc_
  • Chain 'D':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62988 (0-End)
      • insertion (9-15)
    Domains in SCOPe 2.07: d2gbkd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gbkA (A:)
    mqifvktltqvrelvggktitlevepsdtienvkakiqdkegippdqqrlifagkqledg
    rtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gbkA (A:)
    mqifvktltqvrelvggktitlevepsdtienvkakiqdkegippdqqrlifagkqledg
    rtlsdyniqkestlhlvlrlrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gbkB (B:)
    mqifvktltqvrelvggktitlevepsdtienvkakiqdkegippdqqrlifagkqledg
    rtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gbkB (B:)
    mqifvktltqvrelvggktitlevepsdtienvkakiqdkegippdqqrlifagkqledg
    rtlsdyniqkestlhlvlrlrg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gbkC (C:)
    mqifvktltqvrelvggktitlevepsdtienvkakiqdkegippdqqrlifagkqledg
    rtlsdyniqkestlhlvlrlrgg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gbkD (D:)
    mqifvktltqvrelvggktitlevepsdtienvkakiqdkegippdqqrlifagkqledg
    rtlsdyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gbkD (D:)
    mqifvktltqvrelvggktitlevepsdtienvkakiqdkegippdqqrlifagkqledg
    rtlsdyniqkestlhlvlrl