PDB entry 2gba

View 2gba on RCSB PDB site
Description: Reduced Cu(I) form at pH 4 of P52G mutant of amicyanin
Class: electron transport
Keywords: beta-sandwich, ELECTRON TRANSPORT
Deposited on 2006-03-10, released 2006-08-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 0.92 Å
R-factor: 0.111
AEROSPACI score: 1.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amicyanin
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: mauC, ami
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22364 (0-104)
      • engineered (51)
    Domains in SCOPe 2.04: d2gbaa_
  • Heterogens: CU1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gbaA (A:)
    dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamghnvhfvag
    vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve