PDB entry 2gb3

View 2gb3 on RCSB PDB site
Description: Crystal structure of Aspartate aminotransferase (tm1698) from Thermotoga maritima at 2.50 A resolution
Class: transferase
Keywords: tm1698, Aspartate aminotransferase, Structural Genomics, PSI, Protein Structure Initiative, Joint Center for Structural Genomics, JCSG, TRANSFERASE
Deposited on 2006-03-09, released 2006-03-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.231
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate aminotransferase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: tm1698
    Database cross-references and differences (RAF-indexed):
    • GB AAD36765
      • modified residue (36)
      • modified residue (156)
      • modified residue (195)
      • modified residue (243)
      • modified residue (267)
      • modified residue (346)
      • modified residue (352)
      • modified residue (358)
      • modified residue (395)
      • modified residue (400)
    Domains in SCOPe 2.08: d2gb3a1
  • Chain 'B':
    Compound: aspartate aminotransferase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: tm1698
    Database cross-references and differences (RAF-indexed):
    • GB AAD36765 (12-End)
      • leader sequence (10-11)
      • modified residue (12)
      • modified residue (36)
      • modified residue (156)
      • modified residue (195)
      • modified residue (243)
      • modified residue (267)
      • modified residue (346)
      • modified residue (352)
      • modified residue (358)
      • modified residue (395)
      • modified residue (400)
    Domains in SCOPe 2.08: d2gb3b2, d2gb3b3
  • Chain 'C':
    Compound: aspartate aminotransferase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: tm1698
    Database cross-references and differences (RAF-indexed):
    • GB AAD36765
      • modified residue (36)
      • modified residue (156)
      • modified residue (195)
      • modified residue (243)
      • modified residue (267)
      • modified residue (346)
      • modified residue (352)
      • modified residue (358)
      • modified residue (395)
      • modified residue (400)
    Domains in SCOPe 2.08: d2gb3c_
  • Chain 'D':
    Compound: aspartate aminotransferase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: tm1698
    Database cross-references and differences (RAF-indexed):
    • GB AAD36765 (12-End)
      • modified residue (12)
      • modified residue (36)
      • modified residue (156)
      • modified residue (195)
      • modified residue (243)
      • modified residue (267)
      • modified residue (346)
      • modified residue (352)
      • modified residue (358)
      • modified residue (395)
      • modified residue (400)
    Domains in SCOPe 2.08: d2gb3d_
  • Chain 'E':
    Compound: aspartate aminotransferase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: tm1698
    Database cross-references and differences (RAF-indexed):
    • GB AAD36765 (12-End)
      • leader sequence (10-11)
      • modified residue (12)
      • modified residue (36)
      • modified residue (156)
      • modified residue (195)
      • modified residue (243)
      • modified residue (267)
      • modified residue (346)
      • modified residue (352)
      • modified residue (358)
      • modified residue (395)
      • modified residue (400)
    Domains in SCOPe 2.08: d2gb3e2, d2gb3e3
  • Chain 'F':
    Compound: aspartate aminotransferase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: tm1698
    Database cross-references and differences (RAF-indexed):
    • GB AAD36765
      • modified residue (36)
      • modified residue (156)
      • modified residue (195)
      • modified residue (243)
      • modified residue (267)
      • modified residue (346)
      • modified residue (352)
      • modified residue (358)
      • modified residue (395)
      • modified residue (400)
    Domains in SCOPe 2.08: d2gb3f_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gb3A (A:)
    mgsdkihhhhhhmdvfsdrvllteespirklvpfaemakkrgvrihhlnigqpdlktpev
    fferiyenkpevvyyshsagiwelreafasyykrrqrvdvkpenvlvtnggseailfsfa
    vianpgdeilvlepfyanynafakiagvklipvtrrmeegfaipqnlesfinertkgivl
    snpcnptgvvygkdemrylveiaerhglflivdevyseivfrgefasalsiesdkvvvid
    svskkfsacgarvgclitrneelishamklaqgrlapplleqigsvgllnlddsffdfvr
    etyrervetvlkkleehglkrftkpsgafyitaelpvedaeefarwmltdfnmdgettmv
    aplrgfyltpglgkkeiriacvlekdllsraidvlmeglkmfcssrisc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gb3A (A:)
    fsdrvllteespirklvpfaemakkrgvrihhlnigqpdlktpevfferiyenkpevvyy
    shsagiwelreafasyykrrqrvdvkpenvlvtnggseailfsfavianpgdeilvlepf
    yanynafakiagvklipvtrrmeegfaipqnlesfinertkgivlsnpcnptgvvygkde
    mrylveiaerhglflivdevyseivfrgefasalsiesdkvvvidsvskkfsacgarvgc
    litrneelishamklaqgrlapplleqigsvgllnlddsffdfvretyrervetvlkkle
    ehglkrftkpsgafyitaelpvedaeefarwmltdfnmdgettmvaplrgfyltpglgkk
    eiriacvlekdllsraidvlmeglkmfcs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gb3B (B:)
    mgsdkihhhhhhmdvfsdrvllteespirklvpfaemakkrgvrihhlnigqpdlktpev
    fferiyenkpevvyyshsagiwelreafasyykrrqrvdvkpenvlvtnggseailfsfa
    vianpgdeilvlepfyanynafakiagvklipvtrrmeegfaipqnlesfinertkgivl
    snpcnptgvvygkdemrylveiaerhglflivdevyseivfrgefasalsiesdkvvvid
    svskkfsacgarvgclitrneelishamklaqgrlapplleqigsvgllnlddsffdfvr
    etyrervetvlkkleehglkrftkpsgafyitaelpvedaeefarwmltdfnmdgettmv
    aplrgfyltpglgkkeiriacvlekdllsraidvlmeglkmfcssrisc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gb3B (B:)
    hhmdvfsdrvllteespirklvpfaemakkrgvrihhlnigqpdlktpevfferiyenkp
    evvyyshsagiwelreafasyykrrqrvdvkpenvlvtnggseailfsfavianpgdeil
    vlepfyanynafakiagvklipvtrrmeegfaipqnlesfinertkgivlsnpcnptgvv
    ygkdemrylveiaerhglflivdevyseivfrgefasalsiesdkvvvidsvskkfsacg
    arvgclitrneelishamklaqgrlapplleqigsvgllnlddsffdfvretyrervetv
    lkkleehglkrftkpsgafyitaelpvedaeefarwmltdfnmdgettmvaplrgfyltp
    glgkkeiriacvlekdllsraidvlmeglkmfcs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gb3C (C:)
    mgsdkihhhhhhmdvfsdrvllteespirklvpfaemakkrgvrihhlnigqpdlktpev
    fferiyenkpevvyyshsagiwelreafasyykrrqrvdvkpenvlvtnggseailfsfa
    vianpgdeilvlepfyanynafakiagvklipvtrrmeegfaipqnlesfinertkgivl
    snpcnptgvvygkdemrylveiaerhglflivdevyseivfrgefasalsiesdkvvvid
    svskkfsacgarvgclitrneelishamklaqgrlapplleqigsvgllnlddsffdfvr
    etyrervetvlkkleehglkrftkpsgafyitaelpvedaeefarwmltdfnmdgettmv
    aplrgfyltpglgkkeiriacvlekdllsraidvlmeglkmfcssrisc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gb3C (C:)
    dvfsdrvllteespirklvpfaemakkrgvrihhlnigqpdlktpevfferiyenkpevv
    yyshsagiwelreafasyykrrqrvdvkpenvlvtnggseailfsfavianpgdeilvle
    pfyanynafakiagvklipvtrrmeegfaipqnlesfinertkgivlsnpcnptgvvygk
    demrylveiaerhglflivdevyseivfrgefasalsiesdkvvvidsvskkfsacgarv
    gclitrneelishamklaqgrlapplleqigsvgllnlddsffdfvretyrervetvlkk
    leehglkrftkpsgafyitaelpvedaeefarwmltdfnmdgettmvaplrgfyltpglg
    kkeiriacvlekdllsraidvlmeglkmfcs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gb3D (D:)
    mgsdkihhhhhhmdvfsdrvllteespirklvpfaemakkrgvrihhlnigqpdlktpev
    fferiyenkpevvyyshsagiwelreafasyykrrqrvdvkpenvlvtnggseailfsfa
    vianpgdeilvlepfyanynafakiagvklipvtrrmeegfaipqnlesfinertkgivl
    snpcnptgvvygkdemrylveiaerhglflivdevyseivfrgefasalsiesdkvvvid
    svskkfsacgarvgclitrneelishamklaqgrlapplleqigsvgllnlddsffdfvr
    etyrervetvlkkleehglkrftkpsgafyitaelpvedaeefarwmltdfnmdgettmv
    aplrgfyltpglgkkeiriacvlekdllsraidvlmeglkmfcssrisc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gb3D (D:)
    mdvfsdrvllteespirklvpfaemakkrgvrihhlnigqpdlktpevfferiyenkpev
    vyyshsagiwelreafasyykrrqrvdvkpenvlvtnggseailfsfavianpgdeilvl
    epfyanynafakiagvklipvtrrmeegfaipqnlesfinertkgivlsnpcnptgvvyg
    kdemrylveiaerhglflivdevyseivfrgefasalsiesdkvvvidsvskkfsacgar
    vgclitrneelishamklaqgrlapplleqigsvgllnlddsffdfvretyrervetvlk
    kleehglkrftkpsgafyitaelpvedaeefarwmltdfnmdgettmvaplrgfyltpgl
    gkkeiriacvlekdllsraidvlmeglkmf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2gb3E (E:)
    mgsdkihhhhhhmdvfsdrvllteespirklvpfaemakkrgvrihhlnigqpdlktpev
    fferiyenkpevvyyshsagiwelreafasyykrrqrvdvkpenvlvtnggseailfsfa
    vianpgdeilvlepfyanynafakiagvklipvtrrmeegfaipqnlesfinertkgivl
    snpcnptgvvygkdemrylveiaerhglflivdevyseivfrgefasalsiesdkvvvid
    svskkfsacgarvgclitrneelishamklaqgrlapplleqigsvgllnlddsffdfvr
    etyrervetvlkkleehglkrftkpsgafyitaelpvedaeefarwmltdfnmdgettmv
    aplrgfyltpglgkkeiriacvlekdllsraidvlmeglkmfcssrisc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gb3E (E:)
    hhmdvfsdrvllteespirklvpfaemakkrgvrihhlnigqpdlktpevfferiyenkp
    evvyyshsagiwelreafasyykrrqrvdvkpenvlvtnggseailfsfavianpgdeil
    vlepfyanynafakiagvklipvtrrmeegfaipqnlesfinertkgivlsnpcnptgvv
    ygkdemrylveiaerhglflivdevyseivfrgefasalsiesdkvvvidsvskkfsacg
    arvgclitrneelishamklaqgrlapplleqigsvgllnlddsffdfvretyrervetv
    lkkleehglkrftkpsgafyitaelpvedaeefarwmltdfnmdgettmvaplrgfyltp
    glgkkeiriacvlekdllsraidvlmeglkmfc
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2gb3F (F:)
    mgsdkihhhhhhmdvfsdrvllteespirklvpfaemakkrgvrihhlnigqpdlktpev
    fferiyenkpevvyyshsagiwelreafasyykrrqrvdvkpenvlvtnggseailfsfa
    vianpgdeilvlepfyanynafakiagvklipvtrrmeegfaipqnlesfinertkgivl
    snpcnptgvvygkdemrylveiaerhglflivdevyseivfrgefasalsiesdkvvvid
    svskkfsacgarvgclitrneelishamklaqgrlapplleqigsvgllnlddsffdfvr
    etyrervetvlkkleehglkrftkpsgafyitaelpvedaeefarwmltdfnmdgettmv
    aplrgfyltpglgkkeiriacvlekdllsraidvlmeglkmfcssrisc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gb3F (F:)
    vfsdrvllteespirklvpfaemakkrgvrihhlnigqpdlktpevfferiyenkpevvy
    yshsagiwelreafasyykrrqrvdvkpenvlvtnggseailfsfavianpgdeilvlep
    fyanynafakiagvklipvtrrmeegfaipqnlesfinertkgivlsnpcnptgvvygkd
    emrylveiaerhglflivdevyseivfrgefasalsiesdkvvvidsvskkfsacgarvg
    clitrneelishamklaqgrlapplleqigsvgllnlddsffdfvretyrervetvlkkl
    eehglkrftkpsgafyitaelpvedaeefarwmltdfnmdgettmvaplrgfyltpglgk
    keiriacvlekdllsraidvlmeglkmfc