PDB entry 2gb2

View 2gb2 on RCSB PDB site
Description: The P52G mutant of amicyanin in the Cu(II) state.
Class: electron transport
Keywords: beta-sandwich, ELECTRON TRANSPORT
Deposited on 2006-03-09, released 2006-08-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.133
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: amicyanin
  Species: Paracoccus denitrificans [TaxId:266]
  Gene: mauC, ami
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22364 (0-104)
    • engineered (51)
  Domains in SCOPe 2.06: d2gb2a_
• Heterogens: CU, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2gb2A (A:)
  dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamghnvhfvag
  vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve