PDB entry 2gb0

View 2gb0 on RCSB PDB site
Description: Monomeric sarcosine oxidase: structure of a covalently flavinylated amine oxidizing enzyme
Class: oxidoreductase
Keywords: flavoprotein oxidase
Deposited on 2006-03-09, released 2006-03-21
The last revision prior to the SCOP 1.73 freeze date was dated 2006-03-21, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.165
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Monomeric sarcosine oxidase
    Species: Bacillus sp.
    Gene: soxA, sox
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gb0a1, d2gb0a2
  • Chain 'B':
    Compound: Monomeric sarcosine oxidase
    Species: Bacillus sp.
    Gene: soxA, sox
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gb0b1, d2gb0b2
  • Heterogens: PO4, CL, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gb0A (A:)
    sthfdvivvgagsmgmaagyqlakqgvktllvdafdpphtngshhgdtriirhaygegre
    yvplalrsqelwyelekethhkiftktgvlvfgpkgesafvaetmeaakehsltvdlleg
    deinkrwpgitvpenynaifepnsgvlfsencirayrelaeargakvlthtrvedfdisp
    dsvkietangsytadklivsmgawnskllsklnldiplqpyrqvvgffesdeskysndid
    fpgfmvevpngiyygfpsfggcglklgyhtfgqkidpdtinrefgvypedesnlraflee
    ympgangelkrgavcmytktldehfiidlhpehsnvviaagfsghgfkfssgvgevlsql
    altgktehdisifsinrpalkeslqktti
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gb0A (A:)
    sthfdvivvgagsmgmaagyqlakqgvktllvdafdpphtngshhgdtriirhaygegre
    yvplalrsqelwyelekethhkiftktgvlvfgpkgesafvaetmeaakehsltvdlleg
    deinkrwpgitvpenynaifepnsgvlfsencirayrelaeargakvlthtrvedfdisp
    dsvkietangsytadklivsmgawnskllsklnldiplqpyrqvvgffesdeskysndid
    fpgfmvevpngiyygfpsfggcglklgyhtfgqkidpdtinrefgvypedesnlraflee
    ympgangelkrgavcmytktldehfiidlhpehsnvviaagfsghgfkfssgvgevlsql
    altgktehdisifsinrpalkeslqkt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gb0B (B:)
    sthfdvivvgagsmgmaagyqlakqgvktllvdafdpphtngshhgdtriirhaygegre
    yvplalrsqelwyelekethhkiftktgvlvfgpkgesafvaetmeaakehsltvdlleg
    deinkrwpgitvpenynaifepnsgvlfsencirayrelaeargakvlthtrvedfdisp
    dsvkietangsytadklivsmgawnskllsklnldiplqpyrqvvgffesdeskysndid
    fpgfmvevpngiyygfpsfggcglklgyhtfgqkidpdtinrefgvypedesnlraflee
    ympgangelkrgavcmytktldehfiidlhpehsnvviaagfsghgfkfssgvgevlsql
    altgktehdisifsinrpalkeslqktti