PDB entry 2gau

View 2gau on RCSB PDB site
Description: Crystal structure of transcriptional regulator, Crp/Fnr family from Porphyromonas gingivalis (APC80792), Structural genomics, MCSG
Class: transcription
Keywords: Structural genomics, transcriptional regulator, Porphyromonas gingivalis, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, TRANSCRIPTION
Deposited on 2006-03-09, released 2006-04-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.211
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional regulator, Crp/Fnr family
    Species: Porphyromonas gingivalis [TaxId:242619]
    Gene: PG0396
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2gaua1, d2gaua2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gauA (A:)
    mwktasdkglghllrdvwsllneeerelldkeiqpfpckkastvfsegdipnnlfylyeg
    kikilregvygrfhisrivkpgqffgmrpyfaeetcsstaiavenskvlaipveaieall
    kgntsfcryflkalakelgyaerrtvtltqkhvrgrlaetllilkenfgfendgatlsiy
    lsreelatlsnmtvsnairtlstfvsermlaldgkrikiidcdrlqktarsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gauA (A:)
    lghllrdvwsllneeerelldkeiqpfpckkastvfsegdipnnlfylyegkikilrrfh
    isrivkpgqffgmrpyfaeetcsstaiavenskvlaipveaieallkgntsfcryflkal
    akelgyaerrtvtltqkhvrgrlaetllilkenfgfendgatlsiylsreelatlsnmtv
    snairtlstfvsermlaldgkrikiidcdrlqktarsg