PDB entry 2gat

View 2gat on RCSB PDB site
Description: solution structure of the c-terminal domain of chicken gata-1 bound to DNA, nmr, regularized mean structure
Class: transcription/DNA
Keywords: DNA binding protein, transcription factor, zinc binding domain, complex (transcription regulation/DNA), transcription/DNA complex
Deposited on 1997-11-07, released 1998-01-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: erythroid transcription factor gata-1
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2gata_
  • Chain 'B':
    Compound: DNA (5'-d(*gp*tp*tp*gp*cp*ap*gp*ap*tp*ap*ap*ap*cp*ap*tp*t)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*ap*ap*tp*gp*tp*tp*tp*ap*tp*cp*tp*gp*cp*ap*ap*c)-3')
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gatA (A:)
    kragtvcsncqtstttlwrrspmgdpvcnacglyyklhqvnrpltmrkdgiqtrnrkvss
    kgkkrr
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.