PDB entry 2gar

View 2gar on RCSB PDB site
Description: a ph-dependent stablization of an active site loop observed from low and high ph crystal structures of mutant monomeric glycinamide ribonucleotide transformylase
Deposited on 1998-05-13, released 1998-08-12
The last revision prior to the SCOP 1.57 freeze date was dated 1998-08-12, with a file datestamp of 1998-08-12.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.201
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d2gar__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >2gar_ (-)
    mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
    fdsreaydraliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
    hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv
    iswfadgrlkmhenaawldgqrlppqgya
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gar_ (-)
    mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
    fdsreaydraliheidmyapdvvvlagfmrilspafvshyagrllnihpshgtsvhfvtd
    eldggpvilqakvpvfagdsedditarvqtqehaiyplviswfadgrlkmhenaawldgq
    rlppqgya