PDB entry 2gar

View 2gar on RCSB PDB site
Description: a ph-dependent stablization of an active site loop observed from low and high ph crystal structures of mutant monomeric glycinamide ribonucleotide transformylase
Class: purine biosynthesis
Keywords: purine biosynthesis, folate cofactors, loop flexibility, monomer-dimer association, enzyme mechanism, anti-cancer agents
Deposited on 1998-05-13, released 1998-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.201
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycinamide ribonucleotide transformylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08179 (0-End)
      • engineered (69)
    Domains in SCOPe 2.07: d2gara_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2garA (A:)
    mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
    fdsreaydraliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
    hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv
    iswfadgrlkmhenaawldgqrlppqgyaade
    

    Sequence, based on observed residues (ATOM records): (download)
    >2garA (A:)
    mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
    fdsreaydraliheidmyapdvvvlagfmrilspafvshyagrllnihpshgtsvhfvtd
    eldggpvilqakvpvfagdsedditarvqtqehaiyplviswfadgrlkmhenaawldgq
    rlppqgya