PDB entry 2gao

View 2gao on RCSB PDB site
Description: Crystal Structure of Human SAR1a in Complex With GDP
Class: protein transport
Keywords: gtpase, structural genomics consortium, gdp, SGC
Deposited on 2006-03-09, released 2006-03-21
The last revision prior to the SCOP 1.73 freeze date was dated 2006-03-21, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.224
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding protein SAR1a
    Species: HOMO SAPIENS
    Gene: SAR1A, SAR1, SARA, SARA1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gaoa1
  • Chain 'B':
    Compound: GTP-binding protein SAR1a
    Species: HOMO SAPIENS
    Gene: SAR1A, SAR1, SARA, SARA1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2gaob1
  • Heterogens: GDP, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gaoA (A:)
    mgsshhhhhhssglvprgsngfssvlqflglykksgklvflgldnagkttllhmlkddrl
    gqhvptlhptseeltiagmtfttfdlggheqarrvwknylpaingivflvdcadhsrlve
    skvelnalmtdetisnvpililgnkidrtdaiseeklreifglygqttgkgnvtlkelna
    rpmevfmcsvlkrqgygegfrwlsqyid
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gaoA (A:)
    ssvlqflglykksgklvflgldnagkttllhmltseeltiagmtfttfdlrvwknylpai
    ngivflvdcadhsrlveskvelnalmtdetisnvpililgnkidrtdaiseeklreifgl
    ygqttgkgnvtlkelnarpmevfmcsvlkrqgygegfrwlsqyid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gaoB (B:)
    mgsshhhhhhssglvprgsngfssvlqflglykksgklvflgldnagkttllhmlkddrl
    gqhvptlhptseeltiagmtfttfdlggheqarrvwknylpaingivflvdcadhsrlve
    skvelnalmtdetisnvpililgnkidrtdaiseeklreifglygqttgkgnvtlkelna
    rpmevfmcsvlkrqgygegfrwlsqyid
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gaoB (B:)
    svlqflglykksgklvflgldnagkttllhmlkvptlhptseeltiagmtfttfdlrvwk
    nylpaingivflvdcadhsrlveskvelnalmtdetisnvpililgnkidrtdaiseekl
    reifglygqttgkgnvtlkelnarpmevfmcsvlkrqgygegfrwlsqyid