PDB entry 2gac

View 2gac on RCSB PDB site
Description: t152c mutant glycosylasparaginase from flavobacterium meningosepticum
Deposited on 1998-05-29, released 1999-06-08
The last revision prior to the SCOP 1.67 freeze date was dated 1999-06-08, with a file datestamp of 1999-06-07.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.233
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d2gac.1
  • Chain 'B':
    Domains in SCOP 1.67: d2gac.1
  • Chain 'C':
    Domains in SCOP 1.67: d2gac.2
  • Chain 'D':
    Domains in SCOP 1.67: d2gac.2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gacA (A:)
    ttnkpivlstwnfglhanveawkvlskggkaldavekgvrlveddptersvgyggrpdrd
    grvtldacimdenynigsvacmehiknpisvaravmektphvmlvgdgalefalsqgfkk
    enlltaesekewkewlktsqykpivnienhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gacA (A:)
    nkpivlstwnfglhanveawkvlskggkaldavekgvrlveddptersvgyggrpdrdgr
    vtldacimdenynigsvacmehiknpisvaravmektphvmlvgdgalefalsqgfkken
    lltaesekewkewlkt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gacB (B:)
    cigmialdaqgnlsgacttsgmaykmhgrvgdspiigaglfvdneigaatatghgeevir
    tvgthlvvelmnqgrtpqqackeaverivkivnrrgknlkdiqvgfialnkkgeygayci
    qdgfnfavhdqkgnrletpgfalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gacB (B:)
    cigmialdaqgnlsgacttsgmaykmhgrvgdspiigaglfvdneigaatatghgeevir
    tvgthlvvelmnqgrtpqqackeaverivkivnrrgknlkdiqvgfialnkkgeygayci
    qdgfnfavhdqkgnrletp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gacC (C:)
    ttnkpivlstwnfglhanveawkvlskggkaldavekgvrlveddptersvgyggrpdrd
    grvtldacimdenynigsvacmehiknpisvaravmektphvmlvgdgalefalsqgfkk
    enlltaesekewkewlktsqykpivnienhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gacC (C:)
    nkpivlstwnfglhanveawkvlskggkaldavekgvrlveddptersvgyggrpdrdgr
    vtldacimdenynigsvacmehiknpisvaravmektphvmlvgdgalefalsqgfkken
    lltaesekewkewlkt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gacD (D:)
    cigmialdaqgnlsgacttsgmaykmhgrvgdspiigaglfvdneigaatatghgeevir
    tvgthlvvelmnqgrtpqqackeaverivkivnrrgknlkdiqvgfialnkkgeygayci
    qdgfnfavhdqkgnrletpgfalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gacD (D:)
    cigmialdaqgnlsgacttsgmaykmhgrvgdspiigaglfvdneigaatatghgeevir
    tvgthlvvelmnqgrtpqqackeaverivkivnrrgknlkdiqvgfialnkkgeygayci
    qdgfnfavhdqkgnrletp