PDB entry 2ga9

View 2ga9 on RCSB PDB site
Description: Crystal Structure of the Heterodimeric Vaccinia Virus Polyadenylate Polymerase with Bound ATP-gamma-S
Class: transferase
Keywords: polyadenylate polymerase, nucleotidyltransferase, poxvirus, heterodimer, processivity, TRANSFERASE
Deposited on 2006-03-08, released 2006-05-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
    Species: Vaccinia virus [TaxId:10245]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07617 (0-296)
      • engineered (139)
    Domains in SCOPe 2.08: d2ga9a_
  • Chain 'D':
    Compound: Poly(A) polymerase catalytic subunit
    Species: Vaccinia virus [TaxId:10245]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23371 (Start-468)
      • variant (25)
    Domains in SCOPe 2.08: d2ga9d1
  • Heterogens: CA, AGS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ga9A (A:)
    mdvvsldkpfmyfeeidneldyepesanevakklpyqgqlklllgelfflsklqrhgild
    gatvvyigsapgthirylrdhfynlgviikwmlidgrhhdpilnglrdvtlvtrfvdeey
    lrsikkqlhpskiilisdvasaaggnepstadllsnyalqnvmisilnpvasslkwrcpf
    pdqwikdfyiphgnkmlqpfapsysaemrllsiytgenmrltrvtksdavnyekkmyyln
    kivrnkvvvnfdypnqeydyfhmyfmlrtvycnktfpttkakvlflqqsifrflnip
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ga9A (A:)
    mdvvsldkpfmyfeeidneldyepesklpyqgqlklllgelfflsklqrhgildgatvvy
    igsapgthirylrdhfynlgviikwmlidgrhhdpilnglrdvtlvtrfvdeeylrsikk
    qlhpskiilisdvasgnepstadllsnyalqnvmisilnpvasslkwrcpfpdqwikdfy
    iphgnkmlqpfapsysaemrllsiytgenmrltrvtksdavnyekkmyylnkivrnkvvv
    nfdypnqeydyfhmyfmlrtvycnktfpttkakvlflqqsifrflnip
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ga9D (D:)
    pnitlkiietylgrvpsvneyhmlksqarniqkitvfnkdifvslvkknkkrffsdvnts
    aseikdrilsyfskqtqtynigklftiielqsvlvttytdilgvltikapnvisskisyn
    vtsmeelardmlnsmnvavidkakvmgrhnvsslvknvnklmeeylrrhnkscicygsys
    lylinpnirygdidilqtnsrtflidlaflikfitgnniilskipylrnymvikdendnh
    iidsfnirqdtmnvvpkifidniyivdptfqllnmikmfsqidrledlskdpekfnarma
    tmleyvrythgivfdgkrnnmpmkciidennrivtvttkdyfsfkkclvyldenvlssdi
    ldlnadtscdfesvtnsvylihdnimytyfsntillsdkgkvheisarglcahillyqml
    tsgeykqclsdllnsmmnrdkipiyshterdkkpgrhgfiniekdiivf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ga9D (D:)
    nitlkiietylgrvpsvneyhmlksqarniqkitvfnkdifvslvkknkkrffsdvntsa
    seikdrilsyfskqtqtynigklftiielqsvlvttytdilgvltinvtsmeelardmln
    smnvavvsslvknvnklmeeylrrhnkscicygsyslylinpnirygdidilqtnsrtfl
    idlaflikfitgnniilskipylrnymvikdendnhiidsfnirqdtmnvvpkifidniy
    ivdptfqllnmikmfsqidrledlskdpekfnarmatmleyvrythgivfdgkrnnmpmk
    ciidennrivtvttkdyfsfkkclvyldenvlssdildlnadtscdfesvtnsvylihdn
    imytyfsntillsdkgkvheisarglcahillyqmltsgeykqclsdllnsmmnrdkipi
    yshterdkkpgrhgfiniekdiivf