PDB entry 2ga4

View 2ga4 on RCSB PDB site
Description: Stx2 with adenine
Class: toxin
Keywords: AB5-toxin, TOXIN
Deposited on 2006-03-07, released 2006-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Shiga-like toxin II subunit A
    Species: Enterobacteria phage 933W [TaxId:10730]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ga4a_
  • Chain 'B':
    Compound: Shiga-like toxin II subunit B
    Species: Enterobacteria phage 933W [TaxId:10730]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ga4b_
  • Chain 'C':
    Compound: Shiga-like toxin II subunit B
    Species: Enterobacteria phage 933W [TaxId:10730]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ga4c_
  • Chain 'D':
    Compound: Shiga-like toxin II subunit B
    Species: Enterobacteria phage 933W [TaxId:10730]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ga4d_
  • Chain 'E':
    Compound: Shiga-like toxin II subunit B
    Species: Enterobacteria phage 933W [TaxId:10730]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ga4e_
  • Chain 'F':
    Compound: Shiga-like toxin II subunit B
    Species: Enterobacteria phage 933W [TaxId:10730]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ga4f_
  • Heterogens: NA, ADE, FMT, 1PS, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ga4A (A:)
    reftidfstqqsyvsslnsirteistplehisqgttsvsvinhtppgsyfavdirgldvy
    qarfdhlrliieqnnlyvagfvntatntfyrfsdfthisvpgvttvsmttdssyttlqrv
    aalersgmqisrhslvssylalmefsgntmtrdasravlrfvtvtaealrfrqiqrefrq
    alsetapvytmtpgdvdltlnwgrisnvlpeyrgedgvrvgrisfnnisailgtvaviln
    chhqgarsvravneesqpecqitgdrpvikinntlwesntaaaflnrksqflyttgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ga4A (A:)
    reftidfstqqsyvsslnsirteistplehisqgttsvsvinhtppgsyfavdirgldvy
    qarfdhlrliieqnnlyvagfvntatntfyrfsdfthisvpgvttvsmttdssyttlqrv
    aalersgmqisrhslvssylalmefsgntmtrdasravlrfvtvtaealrfrqiqrefrq
    alsetapvytmtpgdvdltlnwgrisnvlpeyrgedgvrvgrisfnnisailgtvaviln
    chqpecqitgdrpvikinntlwesntaaaflnrksqflyttgk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ga4B (B:)
    adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
    gfaevqfnnd
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ga4C (C:)
    adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
    gfaevqfnnd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ga4D (D:)
    adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
    gfaevqfnnd
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ga4E (E:)
    adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
    gfaevqfnnd
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ga4F (F:)
    adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
    gfaevqfnnd