PDB entry 2g9j

View 2g9j on RCSB PDB site
Description: Complex of TM1a(1-14)Zip with TM9a(251-284): a model for the polymerization domain ("overlap region") of tropomyosin
Class: structural protein
Keywords: tropomyosin, peptide complex, overlap complex, intermolecular junction, n-terminal:c-terminal interface, parallel coiled coil, polymerization domain
Deposited on 2006-03-06, released 2006-11-07
The last revision prior to the SCOP 1.75 freeze date was dated 2006-11-07, with a file datestamp of 2007-06-04.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Tropomyosin 1 alpha chain/General control protein GCN4
  Species: Rattus norvegicus/Saccharomyces cerevisiae
  Gene: TPM1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q63609 (1-14)
    • cloning artifact (0)
  • Uniprot P03069 (15-32)
  Domains in SCOP 1.75: d2g9ja1
• Chain 'B':
  Compound: Tropomyosin 1 alpha chain/General control protein GCN4
  Species: Rattus norvegicus/Saccharomyces cerevisiae
  Gene: TPM1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q63609 (1-14)
    • cloning artifact (0)
  • Uniprot P03069 (15-32)
  Domains in SCOP 1.75: d2g9jb1
• Chain 'C':
  Compound: Tropomyosin 1 alpha chain
  Species: Rattus norvegicus
  Gene: TPM1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q63609 (3-36)
    • cloning artifact (0-2)
    • engineered (31)
  Domains in SCOP 1.75: d2g9jc1
• Chain 'D':
  Compound: Tropomyosin 1 alpha chain
  Species: Rattus norvegicus
  Gene: TPM1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q63609 (3-36)
    • cloning artifact (0-2)
    • engineered (31)
  Domains in SCOP 1.75: d2g9jd1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2g9jA (A:)
  gmdaikkkmqmlkldnyhlenevarlkklvger
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2g9jB (B:)
  gmdaikkkmqmlkldnyhlenevarlkklvger
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2g9jC (C:)
  gcgksiddledelyaqklkykaiseeldhalkdmtsi
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2g9jD (D:)
  gcgksiddledelyaqklkykaiseeldhalkdmtsi