PDB entry 2g9i

View 2g9i on RCSB PDB site
Description: Crystal structure of homolog of F420-0:gamma-Glutamyl Ligase from Archaeoglobus fulgidus Reveals a Novel Fold.
Class: ligase
Keywords: CofE homolog, homolog of F420-0:gamma-Glutamyl Ligase, gamma-Glutamyl Ligase, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2006-03-06, released 2006-04-04
The last revision prior to the SCOP 1.73 freeze date was dated 2006-04-04, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.194
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: F420-0:gamma-glutamyl ligase
    Species: Archaeoglobus fulgidus
    Gene: cofE
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28028 (0-248)
      • modified residue (0)
      • modified residue (172)
      • modified residue (205)
      • modified residue (228)
    Domains in SCOP 1.73: d2g9ia1
  • Chain 'B':
    Compound: F420-0:gamma-glutamyl ligase
    Species: Archaeoglobus fulgidus
    Gene: cofE
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28028 (Start-248)
      • modified residue (172)
      • modified residue (205)
      • modified residue (228)
    Domains in SCOP 1.73: d2g9ib1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g9iA (A:)
    mrvevfpveglplikegddlaelissrvrfedgdvlvvcstviskaegrirrleefnpse
    rakeiaarigkpaefvqavleeseevlldfpfllvkakfgnvcvnagidasnveegslll
    ppldpdgsaeklrrrileltgkrvgviitdtngrcfrrgvvgfaigisgvkamkdwigrk
    dlygrelevtvecvadeiaafanllmgeggdgipavvvrglnvagegsmeeiyrseeedv
    irrclkrcl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g9iA (A:)
    mrvevfpveglplikegddlaelissrvrfedgdvlvvcstviskaegrirrleefnpse
    rakeiaarigkpaefvqavleeseevlldfpfllvkakfgnvcvnagidasnveegslll
    ppldpdgsaeklrrrileltgkrvgviitdtngrcfrrgvvgfaigisgvkamkdwvtve
    cvadeiaafanllmggipavvvrglnvagegsmeeiyrseeedvirrclkrcl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2g9iB (B:)
    mrvevfpveglplikegddlaelissrvrfedgdvlvvcstviskaegrirrleefnpse
    rakeiaarigkpaefvqavleeseevlldfpfllvkakfgnvcvnagidasnveegslll
    ppldpdgsaeklrrrileltgkrvgviitdtngrcfrrgvvgfaigisgvkamkdwigrk
    dlygrelevtvecvadeiaafanllmgeggdgipavvvrglnvagegsmeeiyrseeedv
    irrclkrcl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g9iB (B:)
    rvevfpveglplikegddlaelissrvrfedgdvlvvcstviskaegrirrleefnpser
    akeiaarigkpaefvqavleeseevlldfpfllvkakfgnvcvnagidasnveegslllp
    pldpdgsaeklrrrileltgkrvgviitdtngrcfrrgvvgfaigisgvkamkdwvtvec
    vadeiaafanllmggipavvvrglnvagegsmeeiyrseeedvirrclkrcl