PDB entry 2g9f

View 2g9f on RCSB PDB site
Description: Crystal structure of intein-tagged mouse PNGase C-terminal domain
Class: hydrolase
Keywords: beta-sandwich, HYDROLASE
Deposited on 2006-03-06, released 2006-10-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.169
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptide N-glycanase
    Species: Mus musculus [TaxId:10090]
    Gene: Ngly1
    Database cross-references and differences (RAF-indexed):
    • GB AAP03060 (Start-200)
    Domains in SCOPe 2.08: d2g9fa1
  • Heterogens: CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g9fA (A:)
    elggrvsgslawrvargetglerkeilfipsenekiskqfhlrydivrdryirvsdnntn
    isgwengvwkmesifrkvekdwnmvylarkegssfayiswkfecgsaglkvdtvsirtss
    qsfesgsvrwklrsetaqvnllgdknlrsyndfsgatevtleaelsrgdgdvawqhtqlf
    rqslndsgengleiiitfndl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g9fA (A:)
    erkeilfipsenekiskqfhlrydivrdryirvsdnntnisgwengvwkmesifrkvekd
    wnmvylarkegssfayiswkfecgsaglkvdtvsirtssqsfesgsvrwklrsetaqvnl
    lgdknlrsyndfsgatevtleaelsrgdgdvawqhtqlfrqslndsgengleiiitfndl