PDB entry 2g98

View 2g98 on RCSB PDB site
Description: human gamma-D-crystallin
Class: structural protein
Keywords: Crystalline, STRUCTURAL PROTEIN
Deposited on 2006-03-06, released 2006-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.2
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gamma crystallin d
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07320 (0-End)
      • engineered (35)
    Domains in SCOPe 2.07: d2g98a1, d2g98a2
  • Chain 'B':
    Compound: gamma crystallin d
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07320 (0-End)
      • engineered (35)
    Domains in SCOPe 2.07: d2g98b1, d2g98b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g98A (A:)
    gkitlyedrgfqgrhyecssdhpnlqpylsrcnsasvdsgcwmlyeqpnysglqyflrrg
    dyadhqqwmglsdsvrscrliphsgshrirlyeredyrgqmieftedcsclqdrfrfnei
    hslnvlegswvlyelsnyrgrqyllmpgdyrryqdwgatnarvgslrrvidfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g98A (A:)
    gkitlyedrgfqgrhyecssdhpnlqpylsrcnsasvdsgcwmlyeqpnysglqyflrrg
    dyadhqqwmglsdsvrscrliphsgshrirlyeredyrgqmieftedcsclqdrfrfnei
    hslnvlegswvlyelsnyrgrqyllmpgdyrryqdwgatnarvgslrrvid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2g98B (B:)
    gkitlyedrgfqgrhyecssdhpnlqpylsrcnsasvdsgcwmlyeqpnysglqyflrrg
    dyadhqqwmglsdsvrscrliphsgshrirlyeredyrgqmieftedcsclqdrfrfnei
    hslnvlegswvlyelsnyrgrqyllmpgdyrryqdwgatnarvgslrrvidfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g98B (B:)
    gkitlyedrgfqgrhyecssdhpnlqpylsrcnsasvdsgcwmlyeqpnysglqyflrrg
    dyadhqqwmglsdsvrscrliphsgshrirlyeredyrgqmieftedcsclqdrfrfnei
    hslnvlegswvlyelsnyrgrqyllmpgdyrryqdwgatnarvgslrrvi