PDB entry 2g8t

View 2g8t on RCSB PDB site
Description: Indole-amidine Complexes with Bovine Trypsin
Class: hydrolase
Keywords: Trypsin amidine indole inhibition
Deposited on 2006-03-03, released 2006-09-05
The last revision prior to the SCOP 1.73 freeze date was dated 2006-09-05, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.41 Å
R-factor: 0.19
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2g8ta1
  • Heterogens: CA, SO4, MI2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2g8tA (A:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn