PDB entry 2g8n

View 2g8n on RCSB PDB site
Description: Structure of hPNMT with inhibitor 3-Hydroxymethyl-7-(N-4-chlorophenylaminosulfonyl)-THIQ and AdoHcy
Class: transferase
Keywords: methyltransferase
Deposited on 2006-03-02, released 2006-09-12
The last revision prior to the SCOP 1.75 freeze date was dated 2006-09-12, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.201
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phenylethanolamine N-methyltransferase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2g8na1
  • Chain 'B':
    Compound: Phenylethanolamine N-methyltransferase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2g8nb1
  • Heterogens: F83, SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g8nA (A:)
    msgadrspnagaapdsapgqaavasayqrfepraylrnnyapprgdlcnpngvgpwklrc
    laqtfatgevsgrtlidigsgptvyqllsacshfeditmtdflevnrqelgrwlqeepga
    fnwsmysqhacliegkgecwqdkerqlrarvkrvlpidvhqpqplgagspaplpadalvs
    afcleavspdlasfqraldhittllrpgghllligaleeswylagearltvvpvseeevr
    ealvrsgykvrdlrtyimpahlqtgvddvkgvffawaqkvglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g8nA (A:)
    vasayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgevsgrtlidigsgp
    tvyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacliegkgecwqd
    kerqlrarvkrvlpidvhqpqplgagspaplpadalvsafcleavspdlasfqraldhit
    tllrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdlrtyimpahl
    qtgvddvkgvffawaqkv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2g8nB (B:)
    msgadrspnagaapdsapgqaavasayqrfepraylrnnyapprgdlcnpngvgpwklrc
    laqtfatgevsgrtlidigsgptvyqllsacshfeditmtdflevnrqelgrwlqeepga
    fnwsmysqhacliegkgecwqdkerqlrarvkrvlpidvhqpqplgagspaplpadalvs
    afcleavspdlasfqraldhittllrpgghllligaleeswylagearltvvpvseeevr
    ealvrsgykvrdlrtyimpahlqtgvddvkgvffawaqkvglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g8nB (B:)
    pdsapgqaavasayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgevsgr
    tlidigsgptvyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacli
    egkgecwqdkerqlrarvkrvlpidvhqpqplgagspaplpadalvsafcleavspdlas
    fqraldhittllrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdl
    rtyimpahlqtgvddvkgvffawaqkvg