PDB entry 2g8i

View 2g8i on RCSB PDB site
Description: B. halodurans RNase H catalytic domain D192N mutant in complex with Mn2+ and RNA/DNA hybrid (non-P nick at the active site)
Class: hydrolase/RNA/DNA
Keywords: RNase H, Ribonuclease H, RNA/DNA hybrid
Deposited on 2006-03-02, released 2006-04-25
The last revision prior to the SCOP 1.73 freeze date was dated 2006-05-16, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.173
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease H
    Species: Bacillus halodurans
    Gene: rnhA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KEI9
      • engineered (137)
    Domains in SCOP 1.73: d2g8ia1
  • Chain 'B':
    Compound: 5'-r(*up*cp*gp*ap*cp*a)-3'
  • Chain 'C':
    Compound: 5'-d(*ap*tp*gp*tp*cp*g)-3'
  • Heterogens: MN, CL, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2g8iA (A:)
gshmakeeiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaiv
hglrylkernsrkpiysdsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthty
etpilkwqtdkwgeikanygrk

    Sequence, based on observed residues (ATOM records): (download) 
    >2g8iA (A:)
eiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglrylk
ernsrkpiysdsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpilkw
qtdkwgeikanygr

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.