PDB entry 2g85

View 2g85 on RCSB PDB site
Description: Crystal structure of chorismate synthase from Mycobacterium tuberculosis at 2.22 angstrons of resolution
Class: lyase
Keywords: beta-alpha-beta, shikimate pathway, LYASE
Deposited on 2006-03-01, released 2007-03-01
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: 0.173
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chorismate synthase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: aroC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2g85a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g85A (A:)
    mlrwitageshgralvavvegmvagvhvtsadiadqlarrrlgygrgarmtferdavtvl
    sgirhgstlggpiaieigntewpkwetvmaadpvdpaeladvarnapltrprpghadyag
    mlkygfddarpvlerasaretaarvaagtvaraflrqalgvevlshvisigasapyegpp
    praedlpaidaspvraydkaaeadmiaqieaakkdgdtlggvveavalglpvglgsftsg
    dhrldsqlaaavmgiqaikgveigdgfqtarrrgsrahdemypgpdgvvrstnraggleg
    gmtngqplrvraamkpistvpralatvdlatgdeavaihqrsdvcavpaagvvvetmval
    vlaraalekfggdslaetqrniaayqrsvadreapaarvsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g85A (A:)
    mlrwitageshgralvavvegmvagvhvtsadiadqlarrrlgygferdavtvlsgirhg
    stlggpiaieigntewpkwetvmaadpvdpaeladvarnapltrprpghadyagmlkygf
    ddarpvlerasaretaarvaagtvaraflrqalgvevlshvisigasapyegpppraedl
    paidaspvraydkaaeadmiaqieaakkdgdtlggvveavalglpvglgsftsgdhrlds
    qlaaavmgiqaikgveigdgfqtarrrgsrahdemypgpdgvvrstnraggleggmtngq
    plrvraamkpistvpralatvdlatgdeavaihqrsdvcavpaagvvvetmvalvlaraa
    lekfggdslaetqrniaayqrsvadr