PDB entry 2g84

View 2g84 on RCSB PDB site
Description: Cytidine and deoxycytidylate deaminase zinc-binding region from Nitrosomonas europaea.
Class: structural genomics, unknown function
Keywords: Cytidine and deoxycytidylate deaminase, zinc-binding region, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2006-03-01, released 2006-04-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.13
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytidine and deoxycytidylate deaminase zinc-binding region
    Species: Nitrosomonas europaea [TaxId:228410]
    Gene: NE0047
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2g84a1
  • Chain 'B':
    Compound: Cytidine and deoxycytidylate deaminase zinc-binding region
    Species: Nitrosomonas europaea [TaxId:228410]
    Gene: NE0047
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q82Y41 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.06: d2g84b1, d2g84b2
  • Heterogens: ZN, NA, EDO, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g84A (A:)
    ghmndalhiglppflvqanneprvlaapearmgyvlelvraniaadggpfaaavferdsg
    lliaagtnrvvpgrcsaahaeilalslaqakldthdlsadglpacelvtsaepcvmcfga
    viwsgvrslvcaarsddveaigfdegprpenwmggleargitvttgllrdaacallreyn
    acngviynarcgvhkgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g84A (A:)
    mndalhiglppflvqanneprvlaapearmgyvlelvraniaadggpfaaavferdsgll
    iaagtnrvvpgrcsaahaeilalslaqakldthdlsadglpacelvtsaepcvmcfgavi
    wsgvrslvcaarsddveaigfdegprpenwmggleargitvttgllrdaacallreynac
    ngviynarc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2g84B (B:)
    ghmndalhiglppflvqanneprvlaapearmgyvlelvraniaadggpfaaavferdsg
    lliaagtnrvvpgrcsaahaeilalslaqakldthdlsadglpacelvtsaepcvmcfga
    viwsgvrslvcaarsddveaigfdegprpenwmggleargitvttgllrdaacallreyn
    acngviynarcgvhkgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g84B (B:)
    ghmndalhiglppflvqanneprvlaapearmgyvlelvraniaadggpfaaavferdsg
    lliaagtnrvvpgrcsaahaeilalslaqakldthdlsadglpacelvtsaepcvmcfga
    viwsgvrslvcaarsddveaigfdegprpenwmggleargitvttgllrdaacallreyn
    ac