PDB entry 2g82

View 2g82 on RCSB PDB site
Description: High Resolution Structures of Thermus aquaticus Glyceraldehyde-3-Phosphate Dehydrogenase: Role of 220's Loop Motion in Catalysis
Class: oxidoreductase
Keywords: gapdh, g3pdh, glycolysis, oxidoreductase, nad, rossmann fold
Deposited on 2006-03-01, released 2007-03-13
The last revision prior to the SCOP 1.73 freeze date was dated 2007-03-13, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.158
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Thermus aquaticus
    Gene: GAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00361 (0-End)
      • modified residue (148)
    Domains in SCOP 1.73: d2g82a1, d2g82a2
  • Chain 'B':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Thermus aquaticus
    Gene: GAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00361 (0-End)
      • modified residue (148)
    Domains in SCOP 1.73: d2g82b1, d2g82b2
  • Chain 'C':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Thermus aquaticus
    Gene: GAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00361 (0-End)
      • modified residue (148)
    Domains in SCOP 1.73: d2g82c1, d2g82c2
  • Chain 'D':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Thermus aquaticus
    Gene: GAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00361 (0-End)
      • modified residue (148)
    Domains in SCOP 1.73: d2g82d1, d2g82d2
  • Chain 'O':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Thermus aquaticus
    Gene: GAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00361 (0-End)
      • modified residue (148)
    Domains in SCOP 1.73: d2g82o1, d2g82o2
  • Chain 'P':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Thermus aquaticus
    Gene: GAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00361 (0-End)
      • modified residue (148)
    Domains in SCOP 1.73: d2g82p1, d2g82p2
  • Chain 'Q':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Thermus aquaticus
    Gene: GAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00361 (0-End)
      • modified residue (148)
    Domains in SCOP 1.73: d2g82q1, d2g82q2
  • Chain 'R':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Thermus aquaticus
    Gene: GAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00361 (0-End)
      • modified residue (148)
    Domains in SCOP 1.73: d2g82r1, d2g82r2
  • Heterogens: NA, NAD, PGE, IPA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g82A (A:)
    mkvgingfgrigrqvfrilhsrgvevalindltdnktlahllkydsiyhrfpgevayddq
    ylyvdgkairatavkdpkeipwaeagvgvviestgvftdadkakahleggakkviitapa
    kgeditivmgvnheaydpsrhhiisnascttnslapvmkvleeafgvekalmttvhsytn
    dqrlldlphkdlrraraaainiiptttgaakatalvlpslkgrfdgmalrvptatgsisd
    itallkrevtaeevnaalkaaaegplkgilaytedeivlqdivmdphssivdakltkalg
    nmvkvfawydnewgyanrvadlvelvlrkgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g82A (A:)
    mkvgingfgrigrqvfrilhsrgvevalindltdnktlahllkydsiyhrfpgevayddq
    ylyvdgkairatavkdpkeipwaeagvgvviestgvftdadkakahleggakkviitapa
    kgeditivmgvnheaydpsrhhiisnascttnslapvmkvleeafgvekalmttvhsytn
    dqrlldlphkdlrraraaainiiptttgaakatalvlpslkgrfdgmalrvptatgsisd
    itallkrevtaeevnaalkaaaegplkgilaytedeivlqdivmdphssivdakltkalg
    nmvkvfawydnewgyanrvadlvelvlrkg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2g82B (B:)
    mkvgingfgrigrqvfrilhsrgvevalindltdnktlahllkydsiyhrfpgevayddq
    ylyvdgkairatavkdpkeipwaeagvgvviestgvftdadkakahleggakkviitapa
    kgeditivmgvnheaydpsrhhiisnascttnslapvmkvleeafgvekalmttvhsytn
    dqrlldlphkdlrraraaainiiptttgaakatalvlpslkgrfdgmalrvptatgsisd
    itallkrevtaeevnaalkaaaegplkgilaytedeivlqdivmdphssivdakltkalg
    nmvkvfawydnewgyanrvadlvelvlrkgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g82B (B:)
    mkvgingfgrigrqvfrilhsrgvevalindltdnktlahllkydsiyhrfpgevayddq
    ylyvdgkairatavkdpkeipwaeagvgvviestgvftdadkakahleggakkviitapa
    kgeditivmgvnheaydpsrhhiisnascttnslapvmkvleeafgvekalmttvhsytn
    dqrlldlphkdlrraraaainiiptttgaakatalvlpslkgrfdgmalrvptatgsisd
    itallkrevtaeevnaalkaaaegplkgilaytedeivlqdivmdphssivdakltkalg
    nmvkvfawydnewgyanrvadlvelvlrkg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2g82C (C:)
    mkvgingfgrigrqvfrilhsrgvevalindltdnktlahllkydsiyhrfpgevayddq
    ylyvdgkairatavkdpkeipwaeagvgvviestgvftdadkakahleggakkviitapa
    kgeditivmgvnheaydpsrhhiisnascttnslapvmkvleeafgvekalmttvhsytn
    dqrlldlphkdlrraraaainiiptttgaakatalvlpslkgrfdgmalrvptatgsisd
    itallkrevtaeevnaalkaaaegplkgilaytedeivlqdivmdphssivdakltkalg
    nmvkvfawydnewgyanrvadlvelvlrkgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g82C (C:)
    mkvgingfgrigrqvfrilhsrgvevalindltdnktlahllkydsiyhrfpgevayddq
    ylyvdgkairatavkdpkeipwaeagvgvviestgvftdadkakahleggakkviitapa
    kgeditivmgvnheaydpsrhhiisnascttnslapvmkvleeafgvekalmttvhsytn
    dqrlldlphkdlrraraaainiiptttgaakatalvlpslkgrfdgmalrvptatgsisd
    itallkrevtaeevnaalkaaaegplkgilaytedeivlqdivmdphssivdakltkalg
    nmvkvfawydnewgyanrvadlvelvlrkg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2g82D (D:)
    mkvgingfgrigrqvfrilhsrgvevalindltdnktlahllkydsiyhrfpgevayddq
    ylyvdgkairatavkdpkeipwaeagvgvviestgvftdadkakahleggakkviitapa
    kgeditivmgvnheaydpsrhhiisnascttnslapvmkvleeafgvekalmttvhsytn
    dqrlldlphkdlrraraaainiiptttgaakatalvlpslkgrfdgmalrvptatgsisd
    itallkrevtaeevnaalkaaaegplkgilaytedeivlqdivmdphssivdakltkalg
    nmvkvfawydnewgyanrvadlvelvlrkgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g82D (D:)
    mkvgingfgrigrqvfrilhsrgvevalindltdnktlahllkydsiyhrfpgevayddq
    ylyvdgkairatavkdpkeipwaeagvgvviestgvftdadkakahleggakkviitapa
    kgeditivmgvnheaydpsrhhiisnascttnslapvmkvleeafgvekalmttvhsytn
    dqrlldlphkdlrraraaainiiptttgaakatalvlpslkgrfdgmalrvptatgsisd
    itallkrevtaeevnaalkaaaegplkgilaytedeivlqdivmdphssivdakltkalg
    nmvkvfawydnewgyanrvadlvelvlrkg
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2g82O (O:)
    mkvgingfgrigrqvfrilhsrgvevalindltdnktlahllkydsiyhrfpgevayddq
    ylyvdgkairatavkdpkeipwaeagvgvviestgvftdadkakahleggakkviitapa
    kgeditivmgvnheaydpsrhhiisnascttnslapvmkvleeafgvekalmttvhsytn
    dqrlldlphkdlrraraaainiiptttgaakatalvlpslkgrfdgmalrvptatgsisd
    itallkrevtaeevnaalkaaaegplkgilaytedeivlqdivmdphssivdakltkalg
    nmvkvfawydnewgyanrvadlvelvlrkgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g82O (O:)
    mkvgingfgrigrqvfrilhsrgvevalindltdnktlahllkydsiyhrfpgevayddq
    ylyvdgkairatavkdpkeipwaeagvgvviestgvftdadkakahleggakkviitapa
    kgeditivmgvnheaydpsrhhiisnascttnslapvmkvleeafgvekalmttvhsytn
    dqrlldlphkdlrraraaainiiptttgaakatalvlpslkgrfdgmalrvptatgsisd
    itallkrevtaeevnaalkaaaegplkgilaytedeivlqdivmdphssivdakltkalg
    nmvkvfawydnewgyanrvadlvelvlrkg
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2g82P (P:)
    mkvgingfgrigrqvfrilhsrgvevalindltdnktlahllkydsiyhrfpgevayddq
    ylyvdgkairatavkdpkeipwaeagvgvviestgvftdadkakahleggakkviitapa
    kgeditivmgvnheaydpsrhhiisnascttnslapvmkvleeafgvekalmttvhsytn
    dqrlldlphkdlrraraaainiiptttgaakatalvlpslkgrfdgmalrvptatgsisd
    itallkrevtaeevnaalkaaaegplkgilaytedeivlqdivmdphssivdakltkalg
    nmvkvfawydnewgyanrvadlvelvlrkgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g82P (P:)
    mkvgingfgrigrqvfrilhsrgvevalindltdnktlahllkydsiyhrfpgevayddq
    ylyvdgkairatavkdpkeipwaeagvgvviestgvftdadkakahleggakkviitapa
    kgeditivmgvnheaydpsrhhiisnascttnslapvmkvleeafgvekalmttvhsytn
    dqrlldlphkdlrraraaainiiptttgaakatalvlpslkgrfdgmalrvptatgsisd
    itallkrevtaeevnaalkaaaegplkgilaytedeivlqdivmdphssivdakltkalg
    nmvkvfawydnewgyanrvadlvelvlrkg
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2g82Q (Q:)
    mkvgingfgrigrqvfrilhsrgvevalindltdnktlahllkydsiyhrfpgevayddq
    ylyvdgkairatavkdpkeipwaeagvgvviestgvftdadkakahleggakkviitapa
    kgeditivmgvnheaydpsrhhiisnascttnslapvmkvleeafgvekalmttvhsytn
    dqrlldlphkdlrraraaainiiptttgaakatalvlpslkgrfdgmalrvptatgsisd
    itallkrevtaeevnaalkaaaegplkgilaytedeivlqdivmdphssivdakltkalg
    nmvkvfawydnewgyanrvadlvelvlrkgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g82Q (Q:)
    mkvgingfgrigrqvfrilhsrgvevalindltdnktlahllkydsiyhrfpgevayddq
    ylyvdgkairatavkdpkeipwaeagvgvviestgvftdadkakahleggakkviitapa
    kgeditivmgvnheaydpsrhhiisnascttnslapvmkvleeafgvekalmttvhsytn
    dqrlldlphkdlrraraaainiiptttgaakatalvlpslkgrfdgmalrvptatgsisd
    itallkrevtaeevnaalkaaaegplkgilaytedeivlqdivmdphssivdakltkalg
    nmvkvfawydnewgyanrvadlvelvlrkg
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2g82R (R:)
    mkvgingfgrigrqvfrilhsrgvevalindltdnktlahllkydsiyhrfpgevayddq
    ylyvdgkairatavkdpkeipwaeagvgvviestgvftdadkakahleggakkviitapa
    kgeditivmgvnheaydpsrhhiisnascttnslapvmkvleeafgvekalmttvhsytn
    dqrlldlphkdlrraraaainiiptttgaakatalvlpslkgrfdgmalrvptatgsisd
    itallkrevtaeevnaalkaaaegplkgilaytedeivlqdivmdphssivdakltkalg
    nmvkvfawydnewgyanrvadlvelvlrkgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g82R (R:)
    mkvgingfgrigrqvfrilhsrgvevalindltdnktlahllkydsiyhrfpgevayddq
    ylyvdgkairatavkdpkeipwaeagvgvviestgvftdadkakahleggakkviitapa
    kgeditivmgvnheaydpsrhhiisnascttnslapvmkvleeafgvekalmttvhsytn
    dqrlldlphkdlrraraaainiiptttgaakatalvlpslkgrfdgmalrvptatgsisd
    itallkrevtaeevnaalkaaaegplkgilaytedeivlqdivmdphssivdakltkalg
    nmvkvfawydnewgyanrvadlvelvlrkg