PDB entry 2g7y

View 2g7y on RCSB PDB site
Description: Human Cathepsin S with inhibitor CRA-16981
Class: hydrolase
Keywords: papain, cysteine protease, 16981, HYDROLASE
Deposited on 2006-03-01, released 2006-09-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin S
    Species: Homo sapiens [TaxId:9606]
    Gene: CTSS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25774 (Start-216)
      • cloning artifact (187-188)
    Domains in SCOPe 2.08: d2g7ya_
  • Chain 'B':
    Compound: cathepsin S
    Species: Homo sapiens [TaxId:9606]
    Gene: CTSS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25774 (0-216)
      • cloning artifact (187-188)
    Domains in SCOPe 2.08: d2g7yb_
  • Heterogens: MO9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g7yA (A:)
    ilpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcste
    kygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpyg
    redvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkey
    wlvknswghnfgeegyirmarnkgnhcgiasfpsypeighhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g7yA (A:)
    lpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcstek
    ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr
    edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw
    lvknswghnfgeegyirmarnkgnhcgiasfpsypei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2g7yB (B:)
    ilpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcste
    kygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpyg
    redvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkey
    wlvknswghnfgeegyirmarnkgnhcgiasfpsypeighhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g7yB (B:)
    ilpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcste
    kygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpyg
    redvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkey
    wlvknswghnfgeegyirmarnkgnhcgiasfpsypei