PDB entry 2g7s

View 2g7s on RCSB PDB site
Description: The crystal structure of transcriptional regulator, TetR family, from Agrobacterium tumefaciens
Class: transcription
Keywords: transcription, APC5906, TetR, PSI, Protein structure initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2006-02-28, released 2006-03-14
The last revision prior to the SCOP 1.73 freeze date was dated 2007-08-14, with a file datestamp of 2007-08-10.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.139
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TRANSCRIPTIONAL REGULATOR, TetR FAMILY
    Species: Agrobacterium tumefaciens
    Database cross-references and differences (RAF-indexed):
    • GB AAL41301 (Start-193)
      • modified residue (161)
      • modified residue (168)
      • modified residue (187)
    Domains in SCOP 1.73: d2g7sa1, d2g7sa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g7sA (A:)
    gsmknpqskaddilqcartliirggynsfsyadisqvvgirnasihhhfpsksdlvcklv
    sqyrqeaeagiaeleknisdpleqlrayigywegciadathpfcvcallaseipvlpetv
    vlevrahfrslsdwltavlergiaqgrlvltgtaranaeifmatvhgamlsarahgdaat
    fgaitrpmlerita
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g7sA (A:)
    npqskaddilqcartliirggynsfsyadisqvvgirnasihhhfpsksdlvcklvsqyr
    qeaeagiaeleknisdpleqlrayigywegciadathpfcvcallaseipvlpetvvlev
    rahfrslsdwltavlergiaqgrlvltgtaranaeifmatvhgamlsarahgdaatfgai
    trpmlerita