PDB entry 2g7j

View 2g7j on RCSB PDB site
Description: Solution NMR structure of the putative cytoplasmic protein ygaC from Salmonella typhimurium. Northeast Structural Genomics target StR72.
Class: structural genomics, unknown function
Keywords: StR72, AUTOSTRUCTURE, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2006-02-28, released 2006-05-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative cytoplasmic protein
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: ygaC
    Database cross-references and differences (RAF-indexed):
    • GB AAL21686 (0-End)
    Domains in SCOPe 2.08: d2g7ja1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g7jA (A:)
    mylrpdevarvlekagftvdvvtnktygyrrgenyvyvnrearmgrtaliihprlkdrss
    sladpasdiktcdhyqnfplylggethehygiphgfssrialerylnglfgdektdlehh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g7jA (A:)
    mylrpdevarvlekagftvdvvtnktygyrrgenyvyvnrearmgrtaliihprlkdrss
    sladpasdiktcdhyqnfplylggethehygiphgfssrialerylnglfgd