PDB entry 2g7g

View 2g7g on RCSB PDB site
Description: The Crystal Structure of the Putative Transcriptional Regulator Rha04620 from Rhodococcus sp. RHA1
Class: transcription
Keywords: helix-turn-helix, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2006-02-28, released 2006-03-28
The last revision prior to the SCOP 1.73 freeze date was dated 2006-03-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.196
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rha04620, Putative Transcriptional Regulator
    Species: Rhodococcus sp. RHA1
    Gene: rha04620
    Domains in SCOP 1.73: d2g7ga1, d2g7ga2
  • Heterogens: ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g7gA (A:)
    ghmgrprvarldreriaeaalelvdrdgdfrmpdlarhlnvqvssiyhhakgraavvelv
    rhrvvreidgsaferlpwdeafsewarsyraafsrhptairllatetvrdpgslsvyhsa
    aaglrgagfpddhimavitaaenfllgaaldaaapevmieadstttddaltralaaaprg
    peraeqafelglaallagfhhllqecgavqrgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g7gA (A:)
    ldreriaeaalelvdrdgdfrmpdlarhlnvqvssiyhhakgraavvelvrhrvvreidg
    saferlpwdeafsewarsyraafsrhptairllatetvrdpgslsvyhsaaaglrgagfp
    ddhimavitaaenfllgaaldaaapevmieadstttddaltralaaaprgperaeqafel
    glaallagfhhllqecg