PDB entry 2g7b

View 2g7b on RCSB PDB site
Description: Crystal Structure of the R132K:R111L:L121E mutant of Cellular Retinoic Acid Binding Protein Type II In Complex With All-Trans-Retinal At 1.18 Angstroms Resolution
Class: transport protein
Keywords: CRABPII, Retinoic Acid, Retinoids, Beta Barrel, Crystallography, X-Ray, High Resolution, Schiff Base, Protonated Schiff Base, Retinal, TRANSPORT PROTEIN
Deposited on 2006-02-27, released 2007-04-17
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.18 Å
R-factor: 0.13
AEROSPACI score: 0.87 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cellular retinoic acid-binding protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: CRABP2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P29373 (0-136)
    • engineered (110)
    • engineered (120)
    • engineered (131)
  Domains in SCOPe 2.03: d2g7ba_
• Heterogens: NA, AZE, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2g7bA (A:)
  pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
  teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtleltndgeli
  etmtaddvvctkvyvre