PDB entry 2g77

View 2g77 on RCSB PDB site
Description: Crystal Structure of Gyp1 TBC domain in complex with Rab33 GTPase bound to GDP and AlF3
Class: hydrolase activator/protein transport
Keywords: Protein transport, Gyp1 TBC domain, Rab33, vesicular trafficking, HYDROLASE ACTIVATOR/PROTEIN TRANSPORT COMPLEX
Deposited on 2006-02-27, released 2006-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: 0.207
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase-activating protein GYP1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: GYP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08484
      • engineered (177)
    Domains in SCOPe 2.07: d2g77a1, d2g77a2
  • Chain 'B':
    Compound: Ras-related protein Rab-33B
    Species: Mus musculus [TaxId:10090]
    Gene: Rab33b
    Database cross-references and differences (RAF-indexed):
    • Uniprot O35963 (Start-197)
      • modified residue (111)
      • modified residue (114)
      • modified residue (167)
      • modified residue (188)
    Domains in SCOPe 2.07: d2g77b1
  • Heterogens: MG, GDP, AF3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g77A (A:)
    mghhhhhhgslvprgsdvqelnsiiqriskfdnilkdktiinqqdlrqiswngipkihrp
    vvwklligylpvntkrqegflqrkrkeyrdslkhtfsdqhsrdiptwhqieidiprtnph
    iplyqfksvqnslqrilylwairhpasgyvqgindlvtpffetflteylppsqiddvkik
    dpstymvdeqitdleadtfwcltklleqitdnyihgqpgilrqvknlsqlvkridadlyn
    hfqnehvefiqfafrwmncllmrefqmgtvirmwdtylsetsqevtssysmssndikppv
    tpteprvasfvtptkdfqspttalsnmtpnnavedsgkmrqsslnefhvfvcaaflikws
    dqlmemdfqetitflqnpptkdwtetdiemllseafiwqslykdatshwl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g77A (A:)
    qelnsiiqriskfdnilkdktiinqqdlrqiswngipkihrpvvwklligylpvntkrqe
    gflqrkrkeyrdslkhtfsdqhsrdiptwhqieidiprtnphiplyqfksvqnslqrily
    lwairhpasgyvqgindlvtpffetflteylppsqiddvkikdpstymvdeqitdleadt
    fwcltklleqitdnyihgqpgilrqvknlsqlvkridadlynhfqnehvefiqfafrwmn
    cllmrefqmgtvirmwdtylsetsqqsslnefhvfvcaaflikwsdqlmemdfqetitfl
    qnpptkdwtetdiemllseafiwqslykdat
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2g77B (B:)
    mghhhhhhgssscavsgasgclpparsrifkiivigdsnvgktcltyrfcagrfpdrtea
    tigvdfreravdidgerikiqlwdtagqerfrksmvqhyyrnvhavvfvydmtnmasfhs
    lpawieeckqhllandiprilvgnkcdlrsaiqvptdlaqkfadthsmplfetsaknpnd
    ndhveaifmtlahklksh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g77B (B:)
    rsrifkiivigdsnvgktcltyrfcagrfpdrteatigvdfreravdidgerikiqlwdt
    agqerfrksmvqhyyrnvhavvfvydmtnmasfhslpawieeckqhllandiprilvgnk
    cdlrsaiqvptdlaqkfadthsmplfetsaknpndndhveaifmtlahklksh