PDB entry 2g75

View 2g75 on RCSB PDB site
Description: Crystal Structure of anti-SARS m396 Antibody
Class: immune system
Keywords: SARS, S protein, antibody, crystal structure, epitopes, vaccines, inhibitors
Deposited on 2006-02-27, released 2006-04-04
The last revision prior to the SCOP 1.75 freeze date was dated 2006-10-03, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: 0.221
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: IGG Heavy chain
    Species: HOMO SAPIENS
    Gene: recombinant antibody Fab
    Domains in SCOP 1.75: d2g75a1, d2g75a2
  • Chain 'B':
    Compound: IGG Light chain
    Species: HOMO SAPIENS
    Gene: recombinant antibody Fab
    Domains in SCOP 1.75: d2g75b1, d2g75b2
  • Chain 'C':
    Compound: IGG Heavy chain
    Species: HOMO SAPIENS
    Gene: recombinant antibody Fab
    Domains in SCOP 1.75: d2g75c1, d2g75c2
  • Chain 'D':
    Compound: IGG Light chain
    Species: HOMO SAPIENS
    Gene: recombinant antibody Fab
    Domains in SCOP 1.75: d2g75d1, d2g75d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g75A (A:)
    qvqlqqsgaevkkpgssvkvsckasggtfssytiswvrqapgqglewmggitpilgiany
    aqkfqgrvtittdeststaymelsslrsedtavyycardtvmggmdvwgqgttvtvssas
    tkgpsvfplapsskstsggtsalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
    yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdktsplfvhhhhhhgdykd
    dddkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g75A (A:)
    vqlqqsgaevkkpgssvkvsckasggtfssytiswvrqapgqglewmggitpilgianya
    qkfqgrvtittdeststaymelsslrsedtavyycardtvmggmdvwgqgttvtvssast
    kgpsvfplapsskstsggtsalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2g75B (B:)
    syeltqppsvsvapgktaritcggnnigsksvhwyqqkpgqapvlvvyddsdrpsgiper
    fsgsnsgntatltisrveagdeadyycqvwdsssdyvfgtgtkvtvlgqpkanptvtlfp
    psseefqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g75B (B:)
    syeltqppsvsvapgktaritcggnnigsksvhwyqqkpgqapvlvvyddsdrpsgiper
    fsgsnsgntatltisrveagdeadyycqvwdsssdyvfgtgtkvtvlgqpkanptvtlfp
    psseefqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvapte
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2g75C (C:)
    qvqlqqsgaevkkpgssvkvsckasggtfssytiswvrqapgqglewmggitpilgiany
    aqkfqgrvtittdeststaymelsslrsedtavyycardtvmggmdvwgqgttvtvssas
    tkgpsvfplapsskstsggtsalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
    yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdktsplfvhhhhhhgdykd
    dddkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g75C (C:)
    vqlqqsgaevkkpgssvkvsckasggtfssytiswvrqapgqglewmggitpilgianya
    qkfqgrvtittdeststaymelsslrsedtavyycardtvmggmdvwgqgttvtvssast
    kgpsvfplapsskstsggtsalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2g75D (D:)
    syeltqppsvsvapgktaritcggnnigsksvhwyqqkpgqapvlvvyddsdrpsgiper
    fsgsnsgntatltisrveagdeadyycqvwdsssdyvfgtgtkvtvlgqpkanptvtlfp
    psseefqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g75D (D:)
    syeltqppsvsvapgktaritcggnnigsksvhwyqqkpgqapvlvvyddsdrpsgiper
    fsgsnsgntatltisrveagdeadyycqvwdsssdyvfgtgtkvtvlgqpkanptvtlfp
    psseefqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvapte