PDB entry 2g71

View 2g71 on RCSB PDB site
Description: Structure of hPNMT with inhibitor 3-fluoromethyl-7-trifluoropropyl-THIQ and AdoHcy
Class: transferase
Keywords: methyltransferase
Deposited on 2006-02-27, released 2007-02-13
The last revision prior to the SCOP 1.73 freeze date was dated 2007-02-13, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.213
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phenylethanolamine N-methyltransferase
    Species: HOMO SAPIENS
    Gene: PNMT
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2g71a1
  • Chain 'B':
    Compound: Phenylethanolamine N-methyltransferase
    Species: HOMO SAPIENS
    Gene: PNMT
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2g71b1
  • Heterogens: SAH, FTS, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g71A (A:)
    msgadrspnagaapdsapgqaavasayqrfepraylrnnyapprgdlcnpngvgpwklrc
    laqtfatgevsgrtlidigsgptvyqllsacshfeditmtdflevnrqelgrwlqeepga
    fnwsmysqhacliegkgecwqdkerqlrarvkrvlpidvhqpqplgagspaplpadalvs
    afcleavspdlasfqraldhittllrpgghllligaleeswylagearltvvpvseeevr
    ealvrsgykvrdlrtyimpahlqtgvddvkgvffawaqkvglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g71A (A:)
    aavasayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgevsgrtlidigs
    gptvyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacliegkgecw
    qdkerqlrarvkrvlpidvhqpqplgagspaplpadalvsafcleavspdlasfqraldh
    ittllrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdlrtyimpa
    hlqtgvddvkgvffawaqkvg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2g71B (B:)
    msgadrspnagaapdsapgqaavasayqrfepraylrnnyapprgdlcnpngvgpwklrc
    laqtfatgevsgrtlidigsgptvyqllsacshfeditmtdflevnrqelgrwlqeepga
    fnwsmysqhacliegkgecwqdkerqlrarvkrvlpidvhqpqplgagspaplpadalvs
    afcleavspdlasfqraldhittllrpgghllligaleeswylagearltvvpvseeevr
    ealvrsgykvrdlrtyimpahlqtgvddvkgvffawaqkvglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g71B (B:)
    pdsapgqaavasayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgevsgr
    tlidigsgptvyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacli
    egkgecwqdkerqlrarvkrvlpidvhqpqplgagspaplpadalvsafcleavspdlas
    fqraldhittllrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdl
    rtyimpahlqtgvddvkgvffawaqkvg