PDB entry 2g6x

View 2g6x on RCSB PDB site
Description: Crystal structure of a novel green fluorescent protein from marine copepod Pontellina plumata
Class: luminescent protein
Keywords: green fluorescent protein, natural chromophore, rapid maturation, beta can, LUMINESCENT PROTEIN
Deposited on 2006-02-26, released 2006-03-28
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-09-08, with a file datestamp of 2009-09-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: green fluorescent protein 2
    Species: Pontellina plumata [TaxId:239963]
    Gene: ppluGFP2
    Database cross-references and differences (RAF-indexed):
    • GB AAQ01184
      • engineered (4)
      • chromophore (57)
      • engineered (116)
      • engineered (148)
      • engineered (150)
      • engineered (154)
      • engineered (167)
      • engineered (199)
    Domains in SCOPe 2.03: d2g6xa_
  • Chain 'B':
    Compound: green fluorescent protein 2
    Species: Pontellina plumata [TaxId:239963]
    Gene: ppluGFP2
    Database cross-references and differences (RAF-indexed):
    • GB AAQ01184 (1-End)
      • cloning artifact (0)
      • engineered (4)
      • chromophore (57)
      • engineered (116)
      • engineered (148)
      • engineered (150)
      • engineered (154)
      • engineered (167)
      • engineered (199)
    Domains in SCOPe 2.03: d2g6xb_
  • Chain 'C':
    Compound: green fluorescent protein 2
    Species: Pontellina plumata [TaxId:239963]
    Gene: ppluGFP2
    Database cross-references and differences (RAF-indexed):
    • GB AAQ01184 (1-218)
      • engineered (4)
      • chromophore (57)
      • engineered (116)
      • engineered (148)
      • engineered (150)
      • engineered (154)
      • engineered (167)
      • engineered (199)
      • engineered (218)
    Domains in SCOPe 2.03: d2g6xc_
  • Chain 'D':
    Compound: green fluorescent protein 2
    Species: Pontellina plumata [TaxId:239963]
    Gene: ppluGFP2
    Database cross-references and differences (RAF-indexed):
    • GB AAQ01184 (Start-218)
      • engineered (4)
      • chromophore (57)
      • engineered (116)
      • engineered (148)
      • engineered (150)
      • engineered (154)
      • engineered (167)
      • engineered (199)
      • engineered (218)
    Domains in SCOPe 2.03: d2g6xd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g6xA (A:)
    lpameiecritgtlngvefelvgggegtpeqgrmtnkmkstkgaltfspyllshvmgygf
    yhfgtypsgyenpflhainnggytntriekyedggvlhvsfsyryeagrvigdfkvmgtg
    fpedsviftdkiirsnatvehlhpmgdndldgsftrtfslrdggyyssvvdshmhfksai
    hpsilqnggpmfafrrveedhsntelgiveyqhafktpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g6xA (A:)
    ameiecritgtlngvefelvgggegtpeqgrmtnkmkstkgaltfspyllshvmgygfyh
    fgtypsgyenpflhainnggytntriekyedggvlhvsfsyryeagrvigdfkvmgtgfp
    edsviftdkiirsnatvehlhpmgdndldgsftrtfslrdggyyssvvdshmhfksaihp
    silqnggpmfafrrveedhsntelgiveyqhafktp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2g6xB (B:)
    lpameiecritgtlngvefelvgggegtpeqgrmtnkmkstkgaltfspyllshvmgygf
    yhfgtypsgyenpflhainnggytntriekyedggvlhvsfsyryeagrvigdfkvmgtg
    fpedsviftdkiirsnatvehlhpmgdndldgsftrtfslrdggyyssvvdshmhfksai
    hpsilqnggpmfafrrveedhsntelgiveyqhafktpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g6xB (B:)
    lpameiecritgtlngvefelvgggegtpeqgrmtnkmkstkgaltfspyllshvmgygf
    yhfgtypsgyenpflhainnggytntriekyedggvlhvsfsyryeagrvigdfkvmgtg
    fpedsviftdkiirsnatvehlhpmgdndldgsftrtfslrdggyyssvvdshmhfksai
    hpsilqnggpmfafrrveedhsntelgiveyqhafktp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2g6xC (C:)
    lpameiecritgtlngvefelvgggegtpeqgrmtnkmkstkgaltfspyllshvmgygf
    yhfgtypsgyenpflhainnggytntriekyedggvlhvsfsyryeagrvigdfkvmgtg
    fpedsviftdkiirsnatvehlhpmgdndldgsftrtfslrdggyyssvvdshmhfksai
    hpsilqnggpmfafrrveedhsntelgiveyqhafktpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g6xC (C:)
    pameiecritgtlngvefelvgggegtpeqgrmtnkmkstkgaltfspyllshvmgygfy
    hfgtypsgyenpflhainnggytntriekyedggvlhvsfsyryeagrvigdfkvmgtgf
    pedsviftdkiirsnatvehlhpmgdndldgsftrtfslrdggyyssvvdshmhfksaih
    psilqnggpmfafrrveedhsntelgiveyqhafktpd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2g6xD (D:)
    lpameiecritgtlngvefelvgggegtpeqgrmtnkmkstkgaltfspyllshvmgygf
    yhfgtypsgyenpflhainnggytntriekyedggvlhvsfsyryeagrvigdfkvmgtg
    fpedsviftdkiirsnatvehlhpmgdndldgsftrtfslrdggyyssvvdshmhfksai
    hpsilqnggpmfafrrveedhsntelgiveyqhafktpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g6xD (D:)
    ameiecritgtlngvefelvgggegtpeqgrmtnkmkstkgaltfspyllshvmgygfyh
    fgtypsgyenpflhainnggytntriekyedggvlhvsfsyryeagrvigdfkvmgtgfp
    edsviftdkiirsnatvehlhpmgdndldgsftrtfslrdggyyssvvdshmhfksaihp
    silqnggpmfafrrveedhsntelgiveyqhafktpd