PDB entry 2g6q

View 2g6q on RCSB PDB site
Description: Crystal structure of ING2 PHD finger in complex with H3K4Me3 peptide
Class: gene regulation, apoptosis
Keywords: protein-peptide complex, PHD finger, GENE REGULATION, APOPTOSIS
Deposited on 2006-02-24, released 2006-07-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-07-24, with a file datestamp of 2013-07-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.223
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inhibitor of growth protein 2
    Species: Mus musculus [TaxId:10090]
    Gene: ING2, ING1L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2g6qa_
  • Chain 'B':
    Compound: H3K4Me3 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2G6Q (0-End)
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2g6qA (A:)
gsefaidpneptyclcnqvsygemigcdneqcpiewfhfscvsltykpkgkwycpkcrgd
ne

    Sequence, based on observed residues (ATOM records): (download) 
    >2g6qA (A:)
eptyclcnqvsygemigcdneqcpiewfhfscvsltykpkgkwycpkcrgdn

  • Chain 'B':
    No sequence available.