PDB entry 2g6i

View 2g6i on RCSB PDB site
Description: Structure of rat nNOS heme domain (BH2-bound) in the reduced form
Class: oxidoreductase
Keywords: nitric oxide synthase, heme protein, diatomic ligand, oxidoreductase
Deposited on 2006-02-24, released 2006-08-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.226
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitric-oxide synthase, brain
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Nos1, Bnos
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2g6ia_
  • Chain 'B':
    Compound: Nitric-oxide synthase, brain
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Nos1, Bnos
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2g6ib_
  • Heterogens: ACT, ZN, HEM, HBI, ARG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g6iA (A:)
    rflkvknwetdvvltdtlhlkstletgctehicmgsimlpsqhtrkpedvrtkdqlfpla
    kefldqyyssikrfgskahmdrleevnkeieststyqlkdteliygakhawrnasrcvgr
    iqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsq
    liryagykqpdgstlgdpanvqfteiciqqgwkaprgrfdvlplllqangndpelfqipp
    elvlevpirhpkfdwfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdy
    cdnsrynileevakkmdldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesf
    ikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvwkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g6iA (A:)
    rflkvknwetdvvltdtlhlkstletgctehicmgsimlpvrtkdqlfplakefldqyys
    sikrfgskahmdrleevnkeieststyqlkdteliygakhawrnasrcvgriqwsklqvf
    dardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsqliryagykq
    pdgstlgdpanvqfteiciqqgwkaprgrfdvlplllqangndpelfqippelvlevpir
    hpkfdwfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdycdnsrynil
    eevakkmdldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesfikhmeneyr
    crggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2g6iB (B:)
    rflkvknwetdvvltdtlhlkstletgctehicmgsimlpsqhtrkpedvrtkdqlfpla
    kefldqyyssikrfgskahmdrleevnkeieststyqlkdteliygakhawrnasrcvgr
    iqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsq
    liryagykqpdgstlgdpanvqfteiciqqgwkaprgrfdvlplllqangndpelfqipp
    elvlevpirhpkfdwfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdy
    cdnsrynileevakkmdldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesf
    ikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvwkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g6iB (B:)
    rflkvknwetdvvltdtlhlkstletgctehicmgsimlpvrtkdqlfplakefldqyys
    sikrfgskahmdrleevnkeieststyqlkdteliygakhawrnasrcvgriqwsklqvf
    dardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsqliryagykq
    pdgstlgdpanvqfteiciqqgwkaprgrfdvlplllqangndpelfqippelvlevpir
    hpkfdwfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdycdnsrynil
    eevakkmdldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesfikhmeneyr
    crggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvwkg