PDB entry 2g6f

View 2g6f on RCSB PDB site
Description: Crystal Structure of the SH3 Domain of betaPIX in Complex with a High Affinity Peptide from PAK2
Class: signaling protein
Keywords: SH3 domain, Peptide Interaction, SIGNALING PROTEIN
Deposited on 2006-02-24, released 2006-04-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 0.92 Å
R-factor: 0.185
AEROSPACI score: 1.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'X':
  Compound: Rho guanine nucleotide exchange factor 7
  Species: Rattus norvegicus [TaxId:10116]
  Gene: Arhgef7, Pak3bp, Pixb
  Database cross-references and differences (RAF-indexed):
  • Uniprot O55043 (5-58)
    • cloning artifact (0-4)
  Domains in SCOPe 2.08: d2g6fx1, d2g6fx2
• Heterogens: NCO, HOH

PDB Chain Sequences:

• Chain 'X':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2g6fX (X:)
  gplgsvvrakfnfqqtnedelsfskgdvihvtrveeggwwegthngrtgwfpsnyvrei