PDB entry 2g6b

View 2g6b on RCSB PDB site
Description: Crystal structure of human RAB26 in complex with a GTP analogue
Class: structural genomics, unknown function
Keywords: G-PROTEIN, RAB, GTP ANALOGUE, Structural Genomics, Structural Genomics Consortium, SGC, UNKNOWN FUNCTION
Deposited on 2006-02-24, released 2006-03-14
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-26
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB26
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2g6ba1
  • Heterogens: MG, GNP, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g6bA (A:)
    gsgvdfydvafkvmlvgdsgvgktcllvrfkdgaflagtfistvgidfrnkvldvdgvkv
    klqmwdtagqerfrsvthayyrdahallllydvtnkasfdniqawlteiheyaqhdvalm
    llgnkvdsahervvkredgeklakeyglpfmetsaktglnvdlaftaiakelkrrsmkap
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g6bA (A:)
    dfydvafkvmlvgdsgvgktcllvrfkdgaflagtfistvgidfrnkvldvdgvkvklqm
    wdtagqayyrdahallllydvtnkasfdniqawlteiheyaqhdvalmllgnkvdsaher
    vvkredgeklakeyglpfmetsaktglnvdlaftaiakelkr