PDB entry 2g64

View 2g64 on RCSB PDB site
Description: Structure of Caenorhabditis elegans 6-pyruvoyl tetrahydropterin synthase
Class: Lyase
Keywords: TETRAHYDROBIOPTERIN BIOSYNTHESIS, PHOSPHATE ELIMINATION, PTERINE SYNTHESIS, Structural Genomics, PSI, Protein Structure Initiative, New York Structural GenomiX Research Consortium, NYSGXRC
Deposited on 2006-02-24, released 2006-03-14
The last revision prior to the SCOP 1.73 freeze date was dated 2006-11-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.162
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Putative 6-pyruvoyl tetrahydrobiopterin synthase
  Species: Caenorhabditis elegans
  Gene: B0041.6
  Database cross-references and differences (RAF-indexed):
  • Uniprot O02058 (0-139)
    • engineered (139)
  Domains in SCOP 1.73: d2g64a1
• Heterogens: NA, ZN, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2g64A (A:)
  mfrmpivtmervdsfsaahrlhseklsdaenketfgkcnnsnghghnyvwkvklrgevdp
  tsgmvydlaklkkemslvldtvdhrnldkdveffkttvstsenvaiymfeklksvmsnps
  vlykvtieetpkniftykgs