PDB entry 2g64

View 2g64 on RCSB PDB site
Description: Structure of Caenorhabditis elegans 6-pyruvoyl tetrahydropterin synthase
Class: lyase
Keywords: TETRAHYDROBIOPTERIN BIOSYNTHESIS, PHOSPHATE ELIMINATION, PTERINE SYNTHESIS, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, Lyase
Deposited on 2006-02-24, released 2006-03-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative 6-pyruvoyl tetrahydrobiopterin synthase
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: B0041.6
    Database cross-references and differences (RAF-indexed):
    • Uniprot O02058 (0-139)
      • engineered (139)
    Domains in SCOPe 2.08: d2g64a1
  • Heterogens: NA, ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2g64A (A:)
    mfrmpivtmervdsfsaahrlhseklsdaenketfgkcnnsnghghnyvwkvklrgevdp
    tsgmvydlaklkkemslvldtvdhrnldkdveffkttvstsenvaiymfeklksvmsnps
    vlykvtieetpkniftykgs