PDB entry 2g60

View 2g60 on RCSB PDB site
Description: Structure of anti-FLAG M2 Fab domain
Class: immune system
Keywords: antibody, Fab domain, anti-FLAG, IMMUNE SYSTEM
Deposited on 2006-02-23, released 2006-09-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.235
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: anti-FLAG M2 Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2g60h2, d2g60h3
  • Chain 'L':
    Compound: anti-FLAG M2 Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2g60l1, d2g60l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2g60H (H:)
    evqlqqsggelakpgasvkmsckssgytftayaihwakqaagaglewigyiapaagaaay
    naafkgkatlaadkssstaymaaaaltsedsavyycaraaaagadywgqgttltvssakt
    tppsvyplapgsaaqtnsmvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlyt
    lsssvtvtssprpsetvtcnvahpasstkvdkkiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g60H (H:)
    evqlqqsggelakpgasvkmsckssgytftayaihwakqaagaglewigyiapaagaaay
    naafkgkatlaadkssstaymaaaaltsedsavyycaraaaagadywgqgttltvssakt
    tppsvyplapsmvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsssvtv
    tssprpsetvtcnvahpasstkvdkkiv
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2g60L (L:)
    dvlmtqapltlpvslgdqasiscrssqaivhangntylewylqkpgqspalliykvanrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgahapytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g60L (L:)
    dvlmtqapltlpvslgdqasiscrssqaivhangntylewylqkpgqspalliykvanrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgahapytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivks