PDB entry 2g5w

View 2g5w on RCSB PDB site
Description: X-ray crystal structure of Arabidopsis thaliana 12-oxophytodienoate reductase isoform 3 (AtOPR3) in complex with 8-iso prostaglandin A1 and its cofactor, flavin mononucleotide.
Class: oxidoreductase
Keywords: At2g06050, OPR ISOFORM 3, FLAVOPROTEIN, FLAVOENZYME, OXIDOREDUCTASE, XENOBIOTIC REDUCTASE, OLD YELLOW ENZYME, SECONDARY MESSENGER, STRUCTURAL GENOMICS FUNCTIONAL FOLLOW-UP STUDY, PROTEIN STRUCTURE INITIATIVE, PSI, CENTER FOR EUKARYOTIC STRUCTURAL GENOMICS, CESG
Deposited on 2006-02-23, released 2006-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.58 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 12-oxophytodienoate reductase 3
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At2g06050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2g5wa_
  • Chain 'B':
    Compound: 12-oxophytodienoate reductase 3
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At2g06050
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2g5wb_
  • Heterogens: FMN, 8PG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g5wA (A:)
    mtaaqgnsnetlfssykmgrfdlshrvvlapmtrcralngvpnaalaeyyaqrttpggfl
    isegtmvspgsagfphvpgiysdeqveawkqvveavhakggfifcqlwhvgrashavyqp
    nggspisstnkpisenrwrvllpdgshvkypkpraleaseiprvvedyclsalnairagf
    dgieihgahgylidqflkdgindrtdqyggsianrcrflkqvvegvvsaigaskvgvrvs
    paidhldatdsdplslglavvgmlnklqgvngsklaylhvtqpryhaygqtesgrqgsde
    eeaklmkslrmayngtfmssggfnkelgmqavqqgdadlvsygrlfianpdlvsrfkidg
    elnkynrktfytqdpvvgytdypflapfsrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g5wA (A:)
    snetlfssykmgrfdlshrvvlapmtrcralngvpnaalaeyyaqrttpggflisegtmv
    spgsagfphvpgiysdeqveawkqvveavhakggfifcqlwhvgrashavyqpnggspis
    stnkpisenrwrvllpdgshvkypkpraleaseiprvvedyclsalnairagfdgieihg
    ahgylidqflkdgindrtdqyggsianrcrflkqvvegvvsaigaskvgvrvspaidhld
    atdsdplslglavvgmlnklqgvngsklaylhvtqpreaklmkslrmayngtfmssggfn
    kelgmqavqqgdadlvsygrlfianpdlvsrfkidgelnkynrktfytqdpvvgytdypf
    lap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2g5wB (B:)
    mtaaqgnsnetlfssykmgrfdlshrvvlapmtrcralngvpnaalaeyyaqrttpggfl
    isegtmvspgsagfphvpgiysdeqveawkqvveavhakggfifcqlwhvgrashavyqp
    nggspisstnkpisenrwrvllpdgshvkypkpraleaseiprvvedyclsalnairagf
    dgieihgahgylidqflkdgindrtdqyggsianrcrflkqvvegvvsaigaskvgvrvs
    paidhldatdsdplslglavvgmlnklqgvngsklaylhvtqpryhaygqtesgrqgsde
    eeaklmkslrmayngtfmssggfnkelgmqavqqgdadlvsygrlfianpdlvsrfkidg
    elnkynrktfytqdpvvgytdypflapfsrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g5wB (B:)
    netlfssykmgrfdlshrvvlapmtrcralngvpnaalaeyyaqrttpggflisegtmvs
    pgsagfphvpgiysdeqveawkqvveavhakggfifcqlwhvgrashavyqpnggspiss
    tnkpisenrwrvllpdgshvkypkpraleaseiprvvedyclsalnairagfdgieihga
    hgylidqflkdgindrtdqyggsianrcrflkqvvegvvsaigaskvgvrvspaidhlda
    tdsdplslglavvgmlnklqgvngsklaylhvtqpryhayeeeaklmkslrmayngtfms
    sggfnkelgmqavqqgdadlvsygrlfianpdlvsrfkidgelnkynrktfytqdpvvgy
    tdypfl