PDB entry 2g5l

View 2g5l on RCSB PDB site
Description: Streptavidin in complex with Nanotag
Class: peptide binding protein
Keywords: streptavidin, binding peptid, biotin, nanotag, PEPTIDE BINDING PROTEIN
Deposited on 2006-02-23, released 2007-02-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.168
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2g5la_
  • Chain 'B':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2g5lb_
  • Chain 'X':
    Compound: (fme)(asp)(val)(glu)(ala)(trp)(leu)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2G5L (0-6)
  • Chain 'Y':
    Compound: (fme)(asp)(val)(glu)(ala)(trp)(leu)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2G5L (0-6)
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2g5lA (A:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g5lA (A:)
    agitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalg
    wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk
    p
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2g5lB (B:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g5lB (B:)
    gitgtwynqlgstfivtagadgaltgtyyvltgrydsapatdgsgtalgwtvawknahsa
    ttwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk
    

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.