PDB entry 2g5i

View 2g5i on RCSB PDB site
Description: Structure of tRNA-Dependent Amidotransferase GatCAB complexed with ADP-AlF4
Class: ligase
Keywords: multi protein complex, ligase
Deposited on 2006-02-23, released 2006-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.35 Å
R-factor: 0.233
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamyl-tRNA(Gln) amidotransferase subunit A
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: gatA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2g5ia1
  • Chain 'B':
    Compound: Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: gatB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2g5ib1, d2g5ib2
  • Chain 'C':
    Compound: Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: gatC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2g5ic1
  • Heterogens: MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2g5iA (A:)
    msiryesvenlltlikdkkikpsdvvkdiydaieetdptiksflaldkenaikkaqelde
    lqakdqmdgklfgipmgikdniitnglettcaskmlegfvpiyestvmeklhkenavlig
    klnmdefamggstetsyfkktvnpfdhkavpggssggsaaavaaglvplslgsdtggsir
    qpaaycgvvgmkptygrvsrfglvafassldqigpltrnvkdnaivleaisgadvndsts
    apvddvdftseigkdikglkvalpkeylgegvaddvkeavqnavetlkslgavveevslp
    ntkfgipsyyviasseassnlsrfdgirygyhskeahsleelykmsrsegfgkevkrrif
    lgtfalssgyydayykksqkvrtlikndfdkvfenydvvvgptapttafnlgeeiddplt
    myandllttpvnlaglpgisvpcgqsngrpiglqfigkpfdektlyrvayqyetqynlhd
    vyekl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2g5iB (B:)
    mhfetviglevhvelktdskmfspspahfgaepnsntnvidlaypgvlpvvnkravdwam
    raamalnmeiateskfdrknyfypdnpkayqisqfdqpigengyidievdgetkrigitr
    lhmeedagksthkgeyslvdlnrqgtplieivsepdirspkeayayleklrsiiqytgvs
    dvkmeegslrcdanislrpygqekfgtkaelknlnsfnyvrkgleyeekrqeeellngge
    igqetrrfdestgktilmrvkegsddyryfpepdivplyiddawkervrqtipelpderk
    akyvnelglpaydahvltltkemsdffestiehgadvkltsnwlmggvneylnknqvell
    dtkltpenlagmikliedgtmsskiakkvfpelaakggnakqimednglvqisdeatllk
    fvnealdnneqsvedykngkgkamgflvgqimkaskgqanpqlvnqllkqeldkrlehhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g5iB (B:)
    hfetviglevhvelktdskmfspspahfgaepnsntnvidlaypgvlpvvnkravdwamr
    aamalnmeiateskfdrknyfypdnpkayqisqfdqpigengyidievdgetkrigitrl
    hmeedagksthkgeyslvdlnrqgtplieivsepdirspkeayayleklrsiiqytgvsd
    vkmeegslrcdanislrpygqekfgtkaelknlnsfnyvrkgleyeekrqeeellnggei
    gqetrrfdestgktilmrvkegsddyryfpepdivplyiddawkervrqtipelpderka
    kyvnelglpaydahvltltkemsdffestiehgadvkltsnwlmggvneylnknqvelld
    tkltpenlagmikliedgtmsskiakkvfpelaakggnakqimednglvq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2g5iC (C:)
    mtkvtreevehianlarlqispeeteemantlesildfakqndsadtegveptyhvldlq
    nvlredkaikgipqelalknaketedgqfkvptimneeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g5iC (C:)
    kvtreevehianlarlqispeeteemantlesildfakqndsadtegveptyhvldlqnv
    lredkaikgipqelalknaketedgqfkvptimneeda