PDB entry 2g5h

View 2g5h on RCSB PDB site
Description: Structure of tRNA-Dependent Amidotransferase GatCAB
Class: ligase
Keywords: multi protein complex
Deposited on 2006-02-23, released 2006-07-18
The last revision prior to the SCOP 1.73 freeze date was dated 2006-07-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.238
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamyl-tRNA(Gln) amidotransferase subunit A
    Species: Staphylococcus aureus
    Gene: gatA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2g5ha1
  • Chain 'B':
    Compound: Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
    Species: Staphylococcus aureus
    Gene: gatB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2g5hb1, d2g5hb2
  • Chain 'C':
    Compound: Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
    Species: Staphylococcus aureus
    Gene: gatC
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2g5hc1
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2g5hA (A:)
    msiryesvenlltlikdkkikpsdvvkdiydaieetdptiksflaldkenaikkaqelde
    lqakdqmdgklfgipmgikdniitnglettcaskmlegfvpiyestvmeklhkenavlig
    klnmdefamggstetsyfkktvnpfdhkavpggssggsaaavaaglvplslgsdtggsir
    qpaaycgvvgmkptygrvsrfglvafassldqigpltrnvkdnaivleaisgadvndsts
    apvddvdftseigkdikglkvalpkeylgegvaddvkeavqnavetlkslgavveevslp
    ntkfgipsyyviasseassnlsrfdgirygyhskeahsleelykmsrsegfgkevkrrif
    lgtfalssgyydayykksqkvrtlikndfdkvfenydvvvgptapttafnlgeeiddplt
    myandllttpvnlaglpgisvpcgqsngrpiglqfigkpfdektlyrvayqyetqynlhd
    vyekl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2g5hB (B:)
    mhfetviglevhvelktdskmfspspahfgaepnsntnvidlaypgvlpvvnkravdwam
    raamalnmeiateskfdrknyfypdnpkayqisqfdqpigengyidievdgetkrigitr
    lhmeedagksthkgeyslvdlnrqgtplieivsepdirspkeayayleklrsiiqytgvs
    dvkmeegslrcdanislrpygqekfgtkaelknlnsfnyvrkgleyeekrqeeellngge
    igqetrrfdestgktilmrvkegsddyryfpepdivplyiddawkervrqtipelpderk
    akyvnelglpaydahvltltkemsdffestiehgadvkltsnwlmggvneylnknqvell
    dtkltpenlagmikliedgtmsskiakkvfpelaakggnakqimednglvqisdeatllk
    fvnealdnneqsvedykngkgkamgflvgqimkaskgqanpqlvnqllkqeldkrlehhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g5hB (B:)
    fetviglevhvelktdskmfspspahfgaepnsntnvidlaypgvlpvvnkravdwamra
    amalnmeiateskfdrknyfypdnpkayqisqfdqpigengyidievdgetkrigitrlh
    meedagksthkgeyslvdlnrqgtplieivsepdirspkeayayleklrsiiqytgvsdv
    kmeegslrcdanislrpygqekfgtkaelknlnsfnyvrkgleyeekrqeeellnggeig
    qetrrfdestgktilmrvkegsddyryfpepdivplyiddawkervrqtipelpderkak
    yvnelglpaydahvltltkemsdffestiehgadvkltsnwlmggvneylnknqvelldt
    kltpenlagmikliedgtmsskiakkvfpelaakggna
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2g5hC (C:)
    mtkvtreevehianlarlqispeeteemantlesildfakqndsadtegveptyhvldlq
    nvlredkaikgipqelalknaketedgqfkvptimneeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2g5hC (C:)
    tkvtreevehianlarlqispeeteemantlesildfakqndsadtegveptyhvldlqn
    vlredkaikgipqelalknaketedgqfkvptimneeda